CAZyme Information: HMPREF1541_10486-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_10486-t46_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	KB822715|CGC1	46354.56	6.0066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822715:101003-102253(+)

Full Sequence      

MFTRRKQNVIFSCMFAFFFIIFFRLALPADDVADKDATPLQERFPLVWKHVHMAAAHGGA
WHIPSDWLPPNSPPPSNITHAAQIAADVASSESQRYLSHSSIPRIVHQVWKSTNIHHFPN
AALPAVESWLEYATDPTLPSMAYFMWDDEGMLDLIAEANPDFLPHFEALPRPVEKADVFR
VFVCNSVGGVYGDIDTTPLRPPTAWIQPRDIAPWVDPETDTIFVSDDPVALVLGIEADTD
EHADTFWRMGYTYPVQLTQWALAGSRDQPVLNRFLENFRHAMEEAMKAPTDLANAPTSGS
QLRKLDPLELTGPSAITKATKDYLAGVANLRWQALSGLQDGGHSKLVQDTLILPITGFSP
GRGKYGNMGSKPYSDPDARLRHDAQGSWRKFDVVVEIGKACRTVFGGCRYWSKTPG

Enzyme Prediction     

No EC number prediction in HMPREF1541_10486-t46_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.66e-19	96	206	76	178	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.09e-10	125	206	7	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64619.1|GT32	3.22e-135	30	416	40	440
BCR93027.1|GT32	5.29e-135	34	415	31	408
BCS05686.1|GT32	5.29e-135	34	415	31	408
CAK38082.1|GT32	4.28e-134	34	415	31	408
QKX57092.1|GT32	1.84e-133	25	414	26	415

PDB Hits     

HMPREF1541_10486-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.31e-24	99	389	139	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	6.51e-23	75	389	78	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	7.26e-12	96	390	90	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	8.12e-12	100	207	55	160	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.02e-11	102	195	82	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.867378	0.132627

TMHMM  Annotations     

Start	End
9	28