CAZyme Information: HMPREF1541_10383-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_10383-t46_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	KB822714|CGC6	66640.97	4.7982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822714:618706-620619(+)

Full Sequence      

MYLLRLIWQALLIDIADAYYRTGPSYGNNFGVPVRNASYDYVIVGGGTSGLAMAARLAEN
GSYTVAVIEAGGFYGVDNGNISVVPNLGLIYTSPLLVLKDAYPTVDWGITTTNQTGLMGQ
QYHYGRGRTLGGTSALNSLVYHRGTYGFHQRWAELVGDSSYEFDNMLPYFRRSAHYTPPQ
MDKRSENASLPEPSPDAYDEHGGPLEIGYINWPLPFGSWAQLAFDEMGFERISDFNHGIL
KDKHQYLTQCVDPDMKRSSSQASYLDWAIDSQRQNLITYTRTLAKRIIFDSELRATGVEV
TTMNIPYLINATKEVIVSAGAIHSPQLLMVSGIGPAATLQNFSIPVLVDHPGVGQNLWDH
VLFTITHQVNVQGGSLLNIPSVFQEAVVNYKANATGPLSNTGFDFVAWEKLPAAFRANLS
DQAGDDLASFPSDWPELEFIIGDAQAADGNLNSYASVIGGLVAPMSRGFVSISSPDTSDL
PIFDPGWLSHPTDKEVAVQSFRRCRQVFNTTAIQPVLIGPEAVPGPDVQTDEEILAYIQQ
SATTIYHAAGTCKMGTDNDTMAVLDSRARVRGTKGLRVVDASSFPVLLPGHPQGTIYALA
EKIAEDILSSR

Enzyme Prediction     

No EC number prediction in HMPREF1541_10383-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	608	7.4e-172	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.58e-104	38	608	5	532	choline dehydrogenase; Validated
225186	BetA	2.34e-96	35	609	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.38e-44	464	603	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.86e-26	24	611	41	580	Protein HOTHEAD
366272	GMC_oxred_N	9.16e-24	125	360	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW98368.1|AA3_2	6.92e-195	27	610	33	621
UJO15235.1|AA3_2	6.53e-183	27	611	31	625
APA09400.1|AA3_2	2.66e-181	36	607	30	607
QMW37598.1|AA3_2	4.85e-178	19	611	25	628
QMW25513.1|AA3_2	4.85e-178	19	611	25	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.58e-54	34	611	9	530	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YRU_AAA	2.82e-54	33	604	2	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.82e-54	33	604	2	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	3.72e-54	33	604	18	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
3NNE_A	4.17e-54	34	611	9	530	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	5.03e-164	27	607	41	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.61e-162	27	607	40	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	2.74e-155	26	609	33	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	3.11e-155	36	607	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A4UHS8|VBSA_DOTSE	3.06e-150	38	609	75	645	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.411507	0.588484	CS pos: 18-19. Pr: 0.5359

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_10383-t46_1-p1.