CAZyme Information: HMPREF1541_10308-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_10308-t46_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		43941.67	7.9165

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822714:435417-436742(-)

Full Sequence      

MPSFSKMALTAFLACASLVNAHMVMKTPKPFGNPNNSPLDASGSDFPCKGGPYDRSSVQN
VMAIGESQTLSFTGSAVHGGGSCQVSLTTDLQPTKDSKWMVIKSIEGGCPASVAGNLPAD
PNGSGASTFQYTIPEGIAPGEYVIAWTWINKIGNREFYMNCGPATVTGAKKKRYAPAGVS
LARRQSSFPDMFVANLASVNDCKTPESFDYNYPNPGQEVQSAGTGPYTNLACGAGGNNPA
PQPTGAASGSGPGSGTQPSSAPATAPTGGAGGNPGSAQPSGGAGGQPQQPPTGSQPQQPE
QPQQPPSGGQGGTRTGAPGSFATGANPLPPDVGSAPSGDAPAASAPAAPPASTGTASAPP
ASSGGSISGAQPQGSACTDEGAWLCLPGGQSFQRCASGVWSVTQSMAAGMQCTPGGASAN
FQMSRLGGVPKYKREPRRIVV

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	22	223	1.9e-69	0.9738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236090	PRK07764	3.36e-06	232	376	586	736	DNA polymerase III subunits gamma and tau; Validated
236090	PRK07764	5.69e-06	213	363	627	778	DNA polymerase III subunits gamma and tau; Validated
184923	PRK14959	4.59e-05	266	381	373	498	DNA polymerase III subunits gamma and tau; Provisional
236090	PRK07764	7.16e-04	216	367	596	739	DNA polymerase III subunits gamma and tau; Validated
236090	PRK07764	8.22e-04	233	365	386	509	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD60467.1|AA11	8.68e-89	4	437	2	395
QMW31531.1|AA11	1.97e-88	4	437	2	411
QMW43588.1|AA11	1.97e-88	4	437	2	411
QRD90522.1|AA11	1.97e-88	4	437	2	411
BAE61530.1|AA11|1.14.99.53	2.78e-88	4	437	2	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	6.73e-79	22	223	1	203	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

HMPREF1541_10308-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000644	0.999309	CS pos: 21-22. Pr: 0.9658

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_10308-t46_1-p1.