CAZyme Information: HMPREF1541_10265-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_10265-t46_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	KB822714|CGC4	53460.77	5.7793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822714:314798-316317(-)

Full Sequence      

MPAQMAPSFSATSLLGDDLLSAGTRRKTARTARVSSWDHSGLNEDAFIIQPGETALLADI
EGPGKITHLWFVQACRRNLGPGLIPFTKGGAPIMEIGNGLGFNYEDNDPDYYRKVLIKMY
WDDSPTPNVLAPLGDFFCLGHSLAANFQSLPFTVSVRPTDEHKFGGAAALNCYLPMPFKS
RARIEIENQGEHAYVQYFYIDYELQPPTARADGDDEILYFHAHWRRENPTEGWAPNAMQT
NSLETQVPNLDGQGYTILDTKGAGTYIGCNHSVLHFQGTWWGEGDDMFFIDDDTWPPSMH
GTGGEDYFTQGWGMQRNAYPFSGSIVHHEDTDIQPGGFQVSYRWHLADPVRFNKRLTVKM
EHGHANHLRDDWSSTAYWYQTLPGPKLEILPVEARLPNRPTVVQPPEPAADRPLTELQKK
HIEQREERFKAHIKDHEEMMERRAKDSRERAQNNVEIAKDIRRRFLQSLDG

Enzyme Prediction     

No EC number prediction in HMPREF1541_10265-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	112	380	1.4e-78	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	3.20e-107	113	380	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68463.1|GH172	3.23e-269	13	471	7	458
QKX59927.1|GH172	5.99e-239	14	471	4	457
UPK94269.1|GH172	9.15e-239	12	469	4	456
QKD59092.1|GH172	3.39e-237	13	471	6	459
CAP93243.1|GH172	4.65e-236	15	469	3	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	3.47e-147	24	465	12	446	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	3.91e-46	20	380	15	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

HMPREF1541_10265-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000029

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_10265-t46_1-p1.