CAZyme Information: HMPREF1541_10200-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_10200-t46_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919	KB822714|CGC5	103527.08	5.8117

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822714:163717-166476(-)

Full Sequence      

MTAHGKPDSSPYNLDGSSLKLKNGQLDGMVLKTLANKEVVKLPLIASLLDNGKARITIDE
ERRQKGDIELRHNSIARKERYNEAAAWALTGAGLQPQKDAKLSNSNGRSEITWGPKSEYR
LVLSHSPFVVEFYTGEDKQVVLNSRGFMNVEHWRPKIDKPSGDENETEPRDVQPQEDEST
WWEETFNGNTDSKPRGPESVAMDISFPGYGHVYGLAEHTGSLSLKETRGGDGNHDQPYRL
YNSDVFEYELDSPMTLYGSVPFMQAHRKDSTVGVFWLNGAETWVDITKDKHSTLGFGSGV
VDTNTHWMSESGQLDLFVMLDATPKSLSKTFGELTGYTALPPTFGIAYHQCRWNYVSDED
VKDVDRKFDKSNIPYDVIWLDLEYTDDKKYFTWDDMTFPDPIGMEQQLEASERKLVIIID
PHIKNKAGYQVVEELKSKDLGIKNKDGNIFDGWCWPGSSHWIDAFNPAARTWWKSLFPYD
KFKGTLKNVWIWNDMNEPSVFNGPEITMPKDNIHHGNWEHRDVHNINGMTFHNATYHALI
ERKKGEILRPFILTRSFYAGSQRSAAMWTGDNQASWGHLAASIPMILNQGVAGFPFAGAD
IGGFFGNPSKDLQTRWYQAGAFYPFMRAHAHIDTRRREPYLLGEPYTGIMAQAMRLRYAL
LPAWYTAFHEASTDGYPIVRSQYYVHPEDEKGFAIDDQLYVGSTGLLAKPVVTEGAESVE
VYLADDENYFDYFDYTVYNGAGKSHHVAAPLEKIPLLMQGGHIIPRKDRPRKSSGLMKWD
PYTLVLVLDKQGEAEGTLYVDDGETFEYQQGAYIHRRFKLTDGKLSSEDIGTKGAKTAAY
LKTMRDVRVEKIIVVNAPSSWESKAEVPVSGGAAAELIYHAAEGKKAAWAVVRNPGVGVG
TDWVVDFGAAAERNVRTEL

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	317	764	2e-145	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	101	859	67	764	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269889	GH31_GANC_GANAB_alpha	0.0	336	805	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	317	764	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269890	GH31_glucosidase_II_MalA	5.10e-140	336	675	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269888	GH31_MGAM_SI_GAA	2.44e-109	336	672	1	367	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA05923.1|GH31	0.0	10	919	66	965
KAE8380830.1|GH31	0.0	1	907	55	966
CAK40395.1|GH31	0.0	3	907	51	957
CAS97680.1|GH31	0.0	3	907	51	957
ACF60497.1|GH31	0.0	3	907	51	957

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	10	908	37	951	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	10	908	37	951	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEG_A	3.95e-241	6	910	22	914	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5IEF_A	5.40e-241	6	909	22	913	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	2.06e-240	6	910	53	945	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	5.08e-282	17	852	63	881	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	1.06e-239	6	905	54	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q94502|GANAB_DICDI	1.15e-238	181	855	234	896	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|Q9FN05|PSL5_ARATH	2.05e-236	19	905	53	918	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|P79403|GANAB_PIG	3.82e-234	6	905	54	941	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_10200-t46_1-p1.