CAZyme Information: HMPREF1541_09993-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09993-t46_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		47990.69	9.1095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822713:856125-857408(+)

Full Sequence      

MPDSLFSKGLRLLTDPEATRYVVPLLVLAEAALCGLIILKVPYTEIDWSTYMIHIQKYWS
GERVYPKITGPTGPCVYPATYLYIYSALHAVTDGGKDIVTGQIIFAILYLTTLALVMQCY
RNVNAPPWLLIPLVLSKRLHSIFMLRLFNDCWATLFLWTSIYLLQRRKWEAGALIWGVGL
GVKMVLLLAAPALAFILIQGAGFFVALFGGASVIMLQIITAIPFLDPKEGDAAAYFHQAF
DFGRQFLYKWTVNWRFVAEETFLSKGFAVGLLVLHISVLLVFIQTRWQTPSGSPGLQTFL
RRFVIQEKGAVNEDVAAKVTPTFVMDAMLGSMAVGLLCARSLHYQFYAYLGWATPYLLWR
SGGGPAWVLLNWAAQEYSWLVFPSTEFSSMLVVFELAIQVLSGLIAPPVDHMRPPTHVQR
QVRFQAR

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	24	389	3.6e-133	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	1.22e-167	24	389	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72893.1|GT58	6.91e-137	4	401	2	389
QSS55330.1|GT58	2.79e-136	4	401	2	389
SMY27950.1|GT58	5.90e-129	4	420	2	413
SMQ54309.1|GT58	8.35e-129	4	420	2	413
SMR58736.1|GT58	8.35e-129	4	420	2	413

PDB Hits     

HMPREF1541_09993-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WVG2|ALG3_ASPFU	7.25e-132	15	404	21	400	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	3.13e-129	15	405	13	393	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	5.32e-129	15	419	75	472	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	7.68e-127	15	404	13	392	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|Q9C1K8|ALG3_NEUCR	4.43e-123	19	400	33	415	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000001

TMHMM  Annotations     

Start	End
21	43
98	117
142	164
174	196
203	225
261	283