CAZyme Information: HMPREF1541_09643-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09643-t46_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		44477.79	7.1269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822712:1381831-1383000(-)

Full Sequence      

MKIGAKDISVPNEFSLPKQIQRMLPAFGALFLFVMYLSGCFDSSSPGLHRKKSEHFPRKV
WQTWKVDAFGFEEKDSKVARTWTAKNPDYRYEVLTDQNDLAYVETHFGADGLNRLDIVYM
YRELRLPIIKADMLRYLVMYVEGGVYTDIDVEALRPINKFIPERYSERGIDMVIGIEIDQ
PDFHDHPILGKKCMSFCQWTFMAKPGLPVMLDLIENIVKWLKDVAMEQQVPISDIQLDFD
QVISGTGPSAFTRAILEYLSRRAGRQITWDLFHNMGESKLVENVLVLTVEAFAAGQGHSD
SGNHNAKQALVKHHYHASGWPTNHPRYSHPTLGTVESCNWDPVCVKAWDDNKAGFDSLSE
EEQAAQIALKQQGGQQPKNKRQARRTRPR

Enzyme Prediction     

No EC number prediction in HMPREF1541_09643-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	163	1.6e-18	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.75e-27	50	312	76	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.91e-13	73	167	2	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW98346.1|GT32	2.62e-193	1	367	1	371
SMY25259.1|GT32	2.41e-182	4	372	11	380
SMR53774.1|GT32	2.41e-182	4	372	11	380
SMQ51614.1|GT32	2.41e-182	4	372	11	380
SMR56074.1|GT32	2.41e-182	4	372	11	380

PDB Hits     

HMPREF1541_09643-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	5.73e-43	57	320	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.60e-37	6	318	73	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.38e-31	56	292	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.22e-27	41	318	90	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.07e-06	48	161	49	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.146172	0.853835	CS pos: 39-40. Pr: 0.8281

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_09643-t46_1-p1.