CAZyme Information: HMPREF1541_09578-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09578-t46_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	KB822712|CGC10	39834.47	7.7156

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822712:1222807-1223865(-)

Full Sequence      

MVAIVITIALLLSYQSSSGPRLWVRAQSSEAHDHQSIQQPLDPDAGLVPSTPSTSLPGVR
DFPRTIWQTGSTDGIKEYAKQSQTWSTQNPNHTHVILTDKDANDFVQQHFPYRPSLLRFW
NELRVPVLRADLLRYLVILSRGGVYSDIDTSCLMPITQWIPAQYRLSANAVVGIEYDDSS
MKMFVRPISFNQWTLMAKPGHPIFERAAARVISNLEFLARQKRQTLSNLKLEMVETLEAT
GPGMITDVVMEVLRDQGHNVDWKTFHALKEPMLLGDVLILPINGFAGHQKHSHSGDPAFG
PKLVQHHFGRTWYRKKPTPEPEQEQGPRKEVALVKEEQVEKQPVGKHEETKA

Enzyme Prediction     

No EC number prediction in HMPREF1541_09578-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	162	4.9e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.31e-27	1	292	10	330	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.76e-11	83	166	9	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW54832.1|GT32	1.42e-94	77	320	4	250
QKX64739.1|GT32	4.98e-52	44	316	43	322
QKX62098.1|GT32	1.57e-49	62	308	55	314
UQC86260.1|GT32	5.45e-49	60	308	76	338
AEO60901.1|GT32	8.82e-49	49	308	61	337

PDB Hits     

HMPREF1541_09578-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.38e-42	56	312	136	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.07e-39	60	312	97	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.24e-35	62	281	130	357	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.93e-20	62	312	96	469	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.33e-10	37	207	40	182	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.233180	0.766797	CS pos: 18-19. Pr: 0.5903

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_09578-t46_1-p1.