CAZyme Information: HMPREF1541_09574-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09574-t46_1-p1
• CAZy Family: GT24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		55710.10	4.5110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822712:1212560-1214346(-)

Full Sequence      

MRTSRRPFAVLAITSLAYCTSGVYAQENSTAASREITGFPPCDALIEAGLGTQVLTATSN
EYESRVDSWWFANARVRPWCFVRPQNTMEVSNVVKVLSDAGSGAGDWHIAVRSGGHSLPS
ANSIVNGVTIDLTMMNNSWYSPEQKVASVEPGAAWKDVYANLLDTANVTVTGGRDGGVGV
GGFLLGGGNSYYSSRNGFGCDTVVNYEVVLANGTIVNANASTNPDLWRALKGGGMNFGIV
TRFDIEAMPAVDFAYGQSVLSTNYSDAVVDVIVNFTNNPEEMENDHLIPLYSYNASEGGQ
SIILIGVNTQGDLNSPAFDGMNSIPALSRTWEHKSLARAANESQVAGGLLYTQSTLTLPA
NPTAVRRATALHSSLIRTLTATLGPENFSASTFLQPLPTQIAKAGSRSGGSNVLGLDRIP
GNAILWVSGVGVQPDAGDAGLAVARAELKKLVAELREFARGQDDVEGMEWTYLNYADADQ
DPLGSYGEENVRFMQEVAERYDPEGFWQGRVPGGFKVGRVEV

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	67	270	2.7e-49	0.4344978165938865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.65e-15	75	252	29	208	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	8.16e-15	78	219	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANF89368.1|AA7	8.60e-17	78	268	61	250
AEO58513.1|AA7|1.1.3.-	8.60e-17	78	268	61	250
ATZ50592.1|AA7	9.29e-16	29	267	13	257
UPK90596.1|AA7	2.15e-15	76	266	18	214
UJO23499.1|AA7	4.58e-15	78	255	63	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	2.97e-18	78	268	61	250	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	1.08e-17	70	265	37	222	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	1.43e-17	70	265	37	222	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYF_A	1.91e-17	70	265	37	222	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYE_A	2.55e-17	70	265	37	222	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0U5GQ05|DRTC_ASPCI	5.76e-70	42	522	45	518	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	2.59e-65	42	520	8	479	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|M2T7Z1|TPCD_COCH5	1.12e-55	21	517	8	517	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|G3Y424|YANF_ASPNA	6.42e-51	18	508	84	567	FAD-dependent monooxygenase yanF OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=yanF PE=1 SV=1
sp|A0A2P1DP98|MACF_PENTR	4.72e-44	42	508	56	506	FAD-dependent monooxygenase macF OS=Penicillium terrestre OX=374132 GN=macF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000985	0.998998	CS pos: 18-19. Pr: 0.5161

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_09574-t46_1-p1.