CAZyme Information: HMPREF1541_09230-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09230-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	KB822712|CGC3	38422.58	4.3358

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822712:378930-380029(+)

Full Sequence      

MLTLLFLLTCSALIVLGRRAESSDCSAFSTDGLAGSHFQYYRFYDFRNISASSTDRRSRR
RDAADVSNRTVVDSSWTDDWYVRDFPRASPGGHSIPVNFIPERVEIVNSTNESEHYGTYL
SLSTARVDEENQESGEITFSEFNVTSASIRVLGRVRGAPGGVAGIFTYQNDTQESDIELF
TRAPGTFVQYSNQPSSCGEPDWIPIPGATVNNTIPQHRTYSDWLVHRLDWVPGRSVFFVN
NEQTNTTDLHVPVSDPPSAVYLDMWSANSTWSGSMDIGQNASFDIQWVELVFNTTDEMIE
ERTEGPVCAVGAIDLQAVEESGAGRVLLMPGVVALLLLTAFAQLLSK

Enzyme Prediction     

No EC number prediction in HMPREF1541_09230-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	79	290	1.5e-52	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.58e-34	74	289	7	208	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6998740.1|GH16_22	1.14e-65	20	310	25	320
CAE7012560.1|GH16_22	4.06e-49	21	314	39	343
QSZ31251.1|GH16_22	2.06e-48	15	304	20	315
CBX92358.1|GH16_22	3.68e-48	21	295	38	310
QPC74272.1|GH16_22	6.99e-48	21	303	25	314

PDB Hits     

HMPREF1541_09230-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

HMPREF1541_09230-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999720	CS pos: 17-18. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_09230-t46_1-p1.