CAZyme Information: HMPREF1541_09228-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09228-t46_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759	KB822712|CGC7	85748.51	8.2373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822712:373136-375415(-)

Full Sequence      

MASSTLSFRSLFKSSRSRRVLQKRSSAQTDSISPPSTWAQVPSSERVDGAADFQTSICVD
NADDPFRDSELAAGPQYGVDSRAPSILQGYDEISLAPSRPESAYSPCSSREDLSASFEHV
PLNPARSSRPSIWRRAKNAFQRQFDLRGFLHLLDFRPWFWPFTWKKYFVLLFLACIIAGI
VISDHYTNWLETSLRITRSYMLPVLIISVCAEPIIIMIALPVANMPDIPAEEVAANLNLA
PDEEDAEQSREPLSGPFETAMVFPCHDTDFRVMKTTIDSCLPHFRPRDIFIVDNGRSKYP
THPKGSFRAYIRSLHPEINYMWSPIGSKNAAQFVGSLAARQKGYRYVMTADDDVCMPKNF
KPPTDLLDDKFLAVAYPIKAMDAKCQSSLWVTAWQDVEYRLSGLAKLAEDRLCGVQFPHG
AGWFVEIDTLIELLEKHHPMDFIAEDCRAGLGISKMRKGIRLDARCFLATEVPATLFGPG
LNWWKQRQKSWEMGRHGLLFAYLGQLLFALPPRKTPQGILWHKLSFAYNICCILIDWLRI
PTIVALGRSAEWWRNAILLMLFSAVPPMAYNYWKCRRRRDMRAPFWAALTYPLYKQLYTL
VSIMGAVRWAGYYLGGHTRSKPIRQMLKEGDWRCFWLDPRFSENPAYLADEAEALAAATT
TTTTTTTFAGKGVEAEKPSNAPVAVPVSVIMPISQHEQICYCDGEHRDPFSDENAIVVTP
PPPPMIPRSPERVYSSSPLARSSASLPSEKTTQGRAPPW

Enzyme Prediction     

No EC number prediction in HMPREF1541_09228-t46_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224136	BcsA	4.33e-11	247	624	44	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	5.76e-05	264	446	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66493.1|GT2	4.57e-183	122	655	108	640
QGI62687.1|GT2	9.14e-183	122	655	108	640
QGI93580.1|GT2	9.14e-183	122	655	108	640
QGI79854.1|GT2	9.14e-183	122	655	108	640
QKD50674.1|GT2	1.76e-178	99	655	83	649

PDB Hits     

HMPREF1541_09228-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

HMPREF1541_09228-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
168	190
200	222
524	546
556	573
585	607