CAZyme Information: HMPREF1541_09137-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_09137-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	KB822712|CGC6	87639.57	6.4768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822712:149094-151467(-)

Full Sequence      

MSLLGGDARQRSTSLERRNPYSSPAVYYDNDNAVRQELLGTGSNRSINSYIKSTRQLTLT
PTRSNYPARRQSHDEWSQQHQELLVDVEATLNDLHEREDINGDQQITIDDHGPKHINLGT
FGSAGFRSVDVRGNYMISNLLQELTLAKALGKKVVKIHRSRLNENPVNRLSRRIRDEFWK
NLERRLDGDLIAKAGKDPKDRTPNPRPRIYVPHGCPEQYDYYCKVARDRPEINLDVRKLP
ENGVDDPRFVRSLNGTPGILALAMNLVKEDGEETLKGEPFIVPGGRFNELYGWDSYMTSL
GLLENGKVEIAKSMVVNFAFCIQHYGKILNANRSYYLTRSQPPFLTDMAMKVYDKIKHQE
GALEFLRLAIRAAIKEYYNVWTSEPRYDVATGLSRYRPRGAGIPPETEASHFTHLLTPYA
EKHGMSFDQFVAAYNADEVEEPDLDEYFLHDRAVRESGHDTTYRLEKVAANLATVDLNSC
LYKYEIDIAWCIRQFFKDQLIMPPEFQTEANRIDGYETSATWDRRAKMRKARMDKFLWNE
KQGMYFDYDTVRKRQTTYKSATTFWPMWAGAATPRQGAALVLNALPKLEDVGGLASGSAD
SIGHNKTELTAPNRQWDYPSGWAPHQMLAWGGLKQYGYVDETQRLAYKWLHMILTSFVDH
NGVVVEKYNVTVESAAHRVEAEYGNQGAAFSGAPLEGFGWVNASYVYGLSLVPMHMRRAL
GILTPWAKFQKATEVKLDGFDDEHTLQEAGEEAVVEAEVEEGQDGPVAVVA

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	164	710	1.6e-142	0.9674134419551935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	0.0	161	711	14	507	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.23e-170	86	718	12	558	Neutral trehalase [Carbohydrate transport and metabolism].
215307	PLN02567	1.80e-54	278	702	141	534	alpha,alpha-trehalase
183934	treF	4.84e-46	278	702	160	536	alpha,alpha-trehalase TreF.
183936	treA	1.30e-45	247	713	129	537	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83003.1|GH37	2.54e-310	15	740	14	734
BAE54706.1|GH37	4.42e-310	1	738	1	729
QMW36943.1|GH37	4.42e-310	1	738	1	729
QMW24943.1|GH37	4.42e-310	1	738	1	729
UCK57284.1|GH37	4.42e-310	1	738	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	4.68e-245	6	729	14	737	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5NIS_A	3.29e-244	86	729	6	642	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5N6N_C	4.47e-244	6	729	19	742	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5M4A_A	5.85e-226	136	729	3	589	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	9.41e-36	278	712	114	502	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A384JRP0|TREA_BOTFB	1.48e-307	9	732	7	724	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42777|TREB_EMENI	4.03e-306	5	736	16	740	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|O42783|TREB_NEUCR	1.46e-304	6	734	8	733	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42622|TREB_MAGO7	3.67e-293	10	734	8	725	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|J5K1E2|TREA_BEAB2	2.19e-291	1	734	1	732	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000003

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_09137-t46_1-p1.