CAZyme Information: HMPREF1541_08994-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_08994-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	KB822725|CGC7	69700.34	4.6467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822725:1380224-1382131(+)

Full Sequence      

MVAPNSLLERSSAVLTVLCVIGLTFSHPGFGDRVARDANSPRSIQDGNEQMPYRDASLSI
NNRVDDLLSRMTLEEKAGQMFHSSLSPGPNGTLDTGNVTERRNSTEFRLKTQYLTHFNLA
GNIVNASETAEFYNLAQKMALSTRLGIPITLSTDPRHAFTESVGASFQAGKFSQWPESLG
LAALRSPDLVRQFADIARQEYLAVGIRGALHPQIDLSTEPRWSRIATTMGEDAELTSELV
VAYLEGFHGGEFGSNSVTTVTKHFPGGGPMENGEDSHFVYGKNQTYPGDNFDYHLIPFKA
AIAAGARQMMPYYSRPIGTEYEEVGFSFNKGIITDLLRGELGFDGIVCSDWGLITDTVIR
GQDMPARAWGLEYLSETERALRILQAGVDQFGGETRPELIVQLVEEGLIPESRLDISVRR
LLSEKFVLGLFDNPFVDPTAAEQIVGKDEFIKAGNDAQRRAYTLLTNKNDILPLKAATPK
FYVEGMNATYLENRGYTVVTEPAQADYAILRLRTPYDPRPGGFEMNYHTGTLEFNATEKE
RHAQIFAAVPTVVDIYLERPAAIPEIAEGAAALLANFGSGPEALLDVVLGVDGYGPEGKL
PFDLPRSDAAVAASREDVPFDTENPVFRFGHGLTY

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	141	390	1.1e-55	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.89e-57	71	503	1	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	9.15e-47	72	423	1	315	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	2.62e-45	18	635	4	648	beta-glucosidase BglX.
178629	PLN03080	6.65e-12	1	475	1	416	Probable beta-xylosidase; Provisional
235417	PRK05337	7.68e-07	230	350	138	249	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUM60063.1|GH3	5.11e-308	6	635	13	633
UQC87911.1|GH3	3.28e-299	45	635	34	630
UJO23767.1|GH3	1.05e-298	38	635	31	634
QBZ61755.1|GH3	1.03e-296	52	635	42	619
QBZ66666.1|GH3	1.48e-291	53	635	42	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	5.03e-52	53	635	40	614	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JGE_A	5.41e-42	53	634	9	602	Crystal structure of barley exohydrolaseI W434A mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6K6V_A Crystal structure of barley exohydrolaseI W434A mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6KUF_A Crystal structure of barley exohydrolaseI W434A mutant in complex with glucose. [Hordeum vulgare subsp. vulgare],6L1J_A Crystal structure of barley exohydrolaseI W434A mutant in complex with 4'-nitrophenyl thiolaminaritrioside [Hordeum vulgare subsp. vulgare],6LBB_A Crystal structure of barley exohydrolaseI W434A mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare]
1LQ2_A	1.26e-41	53	634	5	598	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	1.30e-41	53	634	5	598	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JGL_A	1.36e-41	53	634	9	602	Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGN_A Crystal structure of barley exohydrolaseI W434H in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGO_A Crystal structure of barley exohydrolaseI W434H mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6JGP_A Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BCC6|BGLC_EMENI	2.56e-282	16	635	6	615	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q2UFP8|BGLC_ASPOR	1.06e-281	43	635	35	626	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|B8NGU6|BGLC_ASPFN	1.31e-281	53	635	42	622	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q46684|BGLX_DICCH	4.58e-143	52	635	57	654	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|Q23892|GLUA_DICDI	6.66e-37	64	635	80	699	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000551	0.999411	CS pos: 36-37. Pr: 0.4431

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_08994-t46_1-p1.