CAZyme Information: HMPREF1541_08864-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_08864-t46_1-p1
• CAZy Family: GT17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		33510.21	4.2112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822725:1076178-1077211(-)

Full Sequence      

MLYKSMLTTALLAAPAAVAARGTLGFAVGNTTPDNKCKTTSDYEKDFEAIKANSEAKLIR
TYSNTDSFGNPCDTAGQILPAAKDAGLQVLVGMWPDGGAYSREKKALVDADLEQYGDTVY
GVTVGSEGIYRGTYSEKDLLGWIDDMHKTFPDTLIGTADSWNGWANGSMDGIITSGIKLI
LANGFPYWQYQDINNATKTFFYTMSEALAHVQEVSGSLDDIHFMNGETGWPGDGGDDAGA
AKAGDKNMETFWKESVCGALEWGLDLFWFEAFDEPNKADAVGDDGVAASEKFWGSFTADH
KPKFDMKCGN

Enzyme Prediction     

No EC number prediction in HMPREF1541_08864-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	308	5.9e-29	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.72e-46	22	299	44	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.05e-16	29	308	9	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR43216.1|GH17	3.94e-102	7	310	7	307
SMY20536.1|GH17	3.94e-102	7	310	7	307
SMR45377.1|GH17	1.59e-101	6	310	6	307
SMQ46852.1|GH17	1.59e-101	6	310	6	307
QIX02470.1|GH17	4.90e-99	5	308	6	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.50e-22	34	291	46	286	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.85e-21	34	291	46	286	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.84e-87	1	308	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	1.18e-51	9	308	12	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	2.45e-49	22	308	40	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|Q5AMT2|BGL2_CANAL	1.05e-43	18	308	16	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	5.73e-43	18	308	16	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000408	0.999582	CS pos: 21-22. Pr: 0.9204

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_08864-t46_1-p1.