CAZyme Information: HMPREF1541_08861-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_08861-t46_1-p1
• CAZy Family: GT17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		47611.78	9.2419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822725:1071978-1073372(-)

Full Sequence      

MSEHIPRHLTLKHPLSTLSVIFGIWKAVLLLLALASPGPGYDTSTTLLDWPERYTLLSKL
VRWDSIYFTQIAQHGHLFEQEWAWGTGITSVLAWGSRLLFATSSPSTWQITVSGLLLSHL
TSWMSMMLVWLISAHLAVGTSDAKAQVAFVAALLYIVSPAGIFLSAPYSESLFAALNLLG
FHLFLLGRNGHARGATARAALMTVCGGLASGLATAVRSNGILSGMLYGWDASLSLLALLD
QGLRTQQVTRLLSLIVGGCAVGAGMMLPQYQGYVEYCTGHMESELRPWCKNTIPSIFTFV
QSHYWNVGAFRYWTLSNLPLFLIAAPTLTVLLYSAYGCIRMKLTPPKLQAQAQHSDSVYL
AVPQVVLAVLAITNYHVQIITRLSSGYPYWYLWLALTNVYGLSDARFLKIVVKWMVLYAT
IQAGLYASFLPPA

Enzyme Prediction     

No EC number prediction in HMPREF1541_08861-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	22	433	3.3e-99	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.24e-36	56	433	53	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	7.08e-13	62	433	76	407	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17664.1|GT76	1.84e-98	11	433	19	465
BCR82784.1|GT76	3.67e-98	6	433	12	465
CAP97902.1|GT76	6.62e-98	9	433	18	450
QSS49377.1|GT76	1.47e-97	11	433	20	477
QKX55728.1|GT76	3.53e-96	12	433	302	717

PDB Hits     

HMPREF1541_08861-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	7.23e-93	6	433	10	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.53e-92	12	433	27	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.64e-81	13	433	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.88e-80	12	433	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	7.39e-49	11	433	1	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999874	0.000138

TMHMM  Annotations     

Start	End
13	35
110	132
145	164
168	187
194	216
220	239
251	273
315	337
358	380
386	403
410	432