CAZyme Information: HMPREF1541_08713-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_08713-t46_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	KB822725|CGC4	74517.70	4.6037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822725:669622-671799(+)

Full Sequence      

MRFQVAIAVASACSALANPYAVRQRSIVSEIKDSYDFVIIGGGQAGLVLGGRLSEDSNHT
VLVLESGENGDDYRQRIDTPAYSYFDSLWVTPLNWDFKTSPQPGAKDREMTWPRGKVLGG
SSAINGLYLNKPGEIEINAWQDMLEDMDGADYWGWNNFDNAIKKSETFTAPLDYIVSQSD
ALFTIDDHGSKGPIQASYPAWMPEQNGAWNLALNNMDVPPAKDTYGGKNAGGYISTSSID
PATWKRSYSRTGYLDALPPRPNYDVLANAHVTRIVFDSKSPKNNFTANAVEYSQDGGATK
KTVSVKKEVIVASGSVGSPAVLMHSGIGPKDVLSEAGVDLVHELPGVGQNLQDHLLATVY
WNTTTKTPGAVWVDDSDEQRNDTSFLSFVNDAVAYLNGDRIFGDGFQKFQDSVTSQMSKS
NPTGTTDKNVTAGYRAIYNTTASVILPSEQGQIELLLVTSALDGTVGITAALQHPLSHGA
ITIASNNPIDYPVINPSYLSHPADVTMLREGLKLARKLGETSPMKDTLTAEVTPGTDVQS
DADWEDWMREKVDTEFHPSSSCAMLPLSQGGVVDATLKVYGTFNVRVADASVPPIAFSAH
LVGSTYGIAETASDIIRRWWNLPRPRKDTSKGNKDNNKTNSDGNTSNNDGNDSAESSGSS
SSDNAGNGNAASMAQPFGIAALSAAWAMVMVLV

Enzyme Prediction     

No EC number prediction in HMPREF1541_08713-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	617	5.6e-166	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.67e-95	34	624	5	539	choline dehydrogenase; Validated
225186	BetA	5.14e-91	29	618	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	9.64e-50	36	617	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.52e-35	475	612	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.84e-26	108	355	17	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58234.1|AA3_2	1.43e-264	10	625	7	621
QQK43025.1|AA3_2	3.95e-246	29	623	28	621
QGA17100.1|AA3_2	1.65e-244	4	620	2	614
QRV88352.1|AA3_2	2.28e-191	30	629	23	628
CCA74335.1|AA3_2	7.76e-191	29	622	40	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XUT_A	1.15e-76	34	617	16	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6O9N_A	2.09e-74	8	620	13	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.86e-69	30	618	1	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	2.85e-65	35	621	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	3.86e-63	34	617	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	6.89e-149	15	616	23	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.89e-149	15	616	23	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.42e-68	31	616	10	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q3L245|PDH1_LEUMG	1.47e-64	35	621	41	602	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	1.72e-62	34	618	45	596	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001012	0.998960	CS pos: 17-18. Pr: 0.9559

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_08713-t46_1-p1.