CAZyme Information: HMPREF1541_08279-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_08279-t46_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42404.01	4.8759

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822724:1284319-1285514(-)

Full Sequence      

MQSSMARYIFIVLALGITVFILTTFRASRHLLPANFGPNLLDDAKQNGTDLLRVRNATLG
FQEIKVISMSSRSDKRDAWAVASTMSDFVVQIVDGVDGSSVSPQALPYTMDLKPGVVGCW
RAHMDVLRDIVNRKVSSALIFEDDADWDVSLKSQLVQFARGSRWILNQTDDEPHHSPYGD
GWDMLWIGHCGSRPDPWDNRRFVIPHDPTTEPRDIRTAVALPDYDYWPEDLQPRLVYSQY
YGVCTNAYAVTLAGAMKILYNLSMLPNNGPVDIGLGDMCRDKTDDFNCIGPSPALIGLHR
PAGNPSRWSDIENNQGEDSYAASSPGLMYPVRMNIARLLKGETIFKTDKGTTIGVEEMSL
ADIQAPTGHGEVVEISQHDAIL

Enzyme Prediction     

No EC number prediction in HMPREF1541_08279-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	61	272	1.8e-25	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	3.08e-17	63	148	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	6.85e-05	60	186	1	126	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUW31129.1|GT25	8.02e-68	43	339	55	359
QQK45731.1|GT25	1.95e-64	54	345	56	357
CAP93867.1|GT25	3.76e-64	50	344	56	356
BAE63398.1|GT25	2.78e-63	54	368	61	391
QRD94314.1|GT25	2.78e-63	54	368	61	391

PDB Hits     

HMPREF1541_08279-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PK45|GT251_BOVIN	5.26e-13	59	259	339	511	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q8NBJ5|GT251_HUMAN	9.34e-13	59	259	338	510	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|Q8K297|GT251_MOUSE	2.20e-12	59	259	333	505	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|Q6NVG7|GT252_MOUSE	3.89e-11	59	314	338	574	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
sp|Q8IYK4|GT252_HUMAN	1.62e-10	59	314	339	575	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

Start	End
5	27