CAZyme Information: HMPREF1541_08129-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_08129-t46_1-p1
• CAZy Family: GH75
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	KB822724|CGC12	89619.12	9.3179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822724:878101-880580(-)

Full Sequence      

MSTPNNTLRQRGPKEQQKANGKPKDDLRSVLDSPKQANVSEWDYKLALAIITALAFVTRF
FGISHPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFVGWLVGYDGEFKFENIG
DSYITNNVPYVAYRALPALLGSLTVPTVFLIMWESGYSLPACVLSACLVLFDNSHIGQTR
LILLDATLVFFMATSVLCYVRFYKQRHLPFGRKWWKWLLMTGFSMSCVISVKYVGTFIFV
TIGAAVCIDLWGLLDINRKEGALDMVTFAKHFAARAVGLVIVPFMFYLFWFQVHFAVLTR
SGPGDDFMTPEFQETLSDNIMHASALDILYYDQITMRHKDTKVFLHSHDEKYPLRYDDGR
ISSQGQQVTGYPFNDTNNVWEILPNTPNPDGSHRGSAVMNHDVVKLRHVGTDTFLLSHDV
ASPYYPTNQEFTTVSPELAAEKRHNDTLFEVRIEQGKKKTPFRSKSGQFKLVHFPTRVAM
WTHTKPLPEWAHKQAEINGNKNIQQPSNIWYVDEIANIPEDSPRLSKEPRKVKHVPFLKK
YFELQRSMFAHNNALTSSHPYASLPFQWPFLLRGVSFWTQESTRQQIYFLGNPIGYWIAS
AILAVFGGIWAADQLSLRRGIDALDQRTRSRLYNSTGFFFLCWAAHYLPFYLMGRQLFLH
HYLPAHLASCLVAGAIVEFVFNVEPNVDLDSPTAVASKISEKSKQYVPSAVQEKAAAGRR
RFQTAKERMAGQSLLPTWIAVAVILAAVLYGFVFFFPLTYGWPALDIAQVNRRKWLGYDL
HFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	51	295	1e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	22	784	1	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	6.63e-84	49	299	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	5.52e-77	539	776	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	2.04e-14	340	505	7	168	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	7.49e-09	327	385	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46851.1|GT39	0.0	23	784	28	769
CCD48541.1|GT39	0.0	23	784	28	769
APA05800.1|GT39	0.0	23	784	30	771
CAP95413.1|GT39	0.0	1	784	1	776
CAK42948.1|GT39	0.0	2	784	3	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.13e-97	45	681	50	679	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.36e-91	6	674	21	696	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	9.94e-09	325	519	15	193	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]
1T9F_A	1.39e-06	345	514	24	176	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	7.86e-250	26	784	33	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	7.96e-240	44	776	58	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	3.01e-238	44	784	52	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	1.71e-110	48	680	71	691	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	4.49e-106	43	665	36	669	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000061

TMHMM  Annotations     

Start	End
46	63
88	110
131	153
181	203
230	252
272	291
588	610
630	652
734	756