CAZyme Information: HMPREF1541_07718-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07718-t46_1-p1
• CAZy Family: GH55|GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		90422.99	6.7014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822723:1620206-1622747(-)

Full Sequence      

MKGSAPPTIHTPSPDGDEAPPAYDMGNAQSLIVERTTEATDDGRITVNLDSKLAQVFARL
VDVPEVPELDDAPPRYTEPRSWSVCLNIVIMVVGSRGDVQPFIAMGNELQKFGHRVRIGT
HAVFKDFVQSAGLEFYPIGGDPAQLMAYMVKNPGLIPNMKSLRAGEIGEKRRMVDEMLQG
CWAACVEPDPYTDIPFVANAIISNPPTFAHVHCAQALSVPLHIVFTMPWSPTRAFPHPLA
NVRSTNTDEKLANYLSFGLVNALTWQGLGDVINGFRRRTLGLEEVPVTEGPFLMETLKIP
HTYCWSPGLVPKPRDWENHLDVTGFIFRTPPQYSPPADLDAFLKAGPPPLYIGFGSIVVD
QPDELLATILKALATADVRCIISKGWSSLSSDDVPDNVFFVGDCPHEWLFQQTFAVVHHG
GAGTTAAGLLAGKPTIIVPFFGDQPFWGDRVAATGAGPAPIPHQELSAEKLARAIDYCRT
AEALAAAKAVANKMQAENGVAAAVDSFHRHLQPDKLRCDLIPTLPAVFEYTLSRKIDLKR
AAYEAKIVKLSGLAAETLAQADRVKAKELRIYQSNPVIIENRRWDPITSATSAGVGLAYE
LVSTTNDIWYSPYKMHSRRNKSTNSAASFVSAEEDTSDAGGPSTREHSSIREQIDNNAML
TAKYAGASALNIPKFFGVGVKGLAVDIPRALAEGLRATPKLYGEKVKDHDPITDWKSGFK
VAGKDFAKGVGTGVVDFFVQPYKGARDDGAKGFVTGMGKGFFGTFTKTGSGLTGLYAYPA
QGIWRSIYSASHSDTKRGIMSARRIHDIYISRHEARQFDEEVIIKAFDDL

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	115	510	6.6e-60	0.9607329842931938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.64e-80	86	510	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.05e-54	88	509	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.98e-24	88	236	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	5.11e-17	91	475	1	353	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	3.19e-05	725	783	2351	2409	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92276.1|GT1	4.17e-288	41	827	70	853
CEI68149.1|GT1	8.96e-288	41	827	74	854
CAP79869.1|GT1	2.47e-286	19	828	18	838
QMW26390.1|GT1	3.08e-286	18	830	19	806
QMW38469.1|GT1	3.08e-286	18	830	19	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.12e-83	71	512	5	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.41e-83	71	512	25	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.05e-32	86	503	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.44e-29	86	503	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.64e-24	86	505	1	393	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	3.82e-136	86	514	156	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	4.88e-133	86	515	193	614	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A1CFB3|ATG26_ASPCL	5.04e-82	62	515	878	1329	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1
sp|A7A179|ATG26_YEAS7	3.86e-80	43	512	695	1160	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=ATG26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	4.15e-80	90	511	999	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_07718-t46_1-p1.