CAZyme Information: HMPREF1541_07653-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07653-t46_1-p1
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	KB822723|CGC8	34260.65	4.2431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822723:1458099-1459058(-)

Full Sequence      

MYRSLATLLPILTLTTAIPHASPPTPPSSSGCGKDSPIAPGSRSTNLTITSDDRERSFLL
HIPSSYDAHKPTPLILSFHGRSRNSSYQESLSQFSDPAYNTAWLAVYPQGLNDSWQGPDY
AVEGVSDTLFVSELLDYLEAALCIDTSRVYATGKSNGGGFTGTLACDDTGAGARIAAFAP
VSGAFYDFGEGGSGCRPSRKGLPILEFHGDEDETIPYEGGDGAGGSLPDIGEWVSWWAEW
NECPADGKRVDEEYDGGVTVTSWACGKGEDRLVEGYKVHGLGHDWPSLHPNLDNPDGTVV
EATTVIMEWFARWSLGQEN

Enzyme Prediction     

EC	3.1.1.72:1	3.2.1.8:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	53	231	1.2e-17	0.6079295154185022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	3.36e-36	48	312	39	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
273828	esterase_phb	1.46e-07	60	197	3	147	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
223489	DLH	2.29e-04	135	216	100	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	0.008	50	158	372	484	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO15718.1|CE0	1.94e-31	41	315	20	291
ASB48751.1|CBM6|CE1	1.01e-22	49	316	31	266
ASY31590.1|CBM13|CE0	4.00e-22	36	310	170	448
QUC58776.1|CBM13|CE0	4.21e-21	28	220	35	220
AYC43073.1|CBM13|CE0	7.99e-21	28	220	35	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WYD_A	3.00e-09	58	218	23	171	C-terminal esterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CDX2|FAEC_ASPTN	5.41e-15	29	220	24	198	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|B8YG19|XS20E_NEOPA	5.85e-15	60	283	60	263	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
sp|A2QYU7|FAEC_ASPNC	7.39e-15	28	220	23	198	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q7RWX8|FAED_NEUCR	1.29e-14	11	295	12	276	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
sp|B8N7Z6|FAEC_ASPFN	1.89e-14	28	220	23	198	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000576	0.999383	CS pos: 21-22. Pr: 0.8811

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_07653-t46_1-p1.