CAZyme Information: HMPREF1541_07461-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07461-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	KB822723|CGC7	38922.28	7.3952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822723:1002478-1003658(+)

Full Sequence      

MKSTAIFVLAALAAQTVSAVPHRRDHKILHQARAEAGAVTVTKTIVEPSAVVWVDDAGNT
VSTEYRGSPATAAPEVNNKVGPAIFAGNVQPAVPNVNRPVSSTSASPGSNTGASVGATGN
GGYGICYDMINAQTQCKTADQVNQDFAFLSQNGYKMVRTYDVGCNIGIVATAAAAHGMKV
FAGINSISNVAGDLQKLINYINGNWAAVDTVNIGNEQVNQGAASASQVTAAVAQGRAMLQ
KAGFSGNVVTVDVFNQFIANPSLGSNSDYIAANAHGFFDTTNSAANNGNWLQKEYTQLKS
IANGKKVVITESGWPHAGSANGGASADPGSQSTAIAAIKTAFADKQDSLYVFQAYDAKYK
QPGAMGIEQSFGLFGSN

Enzyme Prediction     

No EC number prediction in HMPREF1541_07461-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	124	376	3.5e-17	0.9614147909967846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.54e-56	99	377	22	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69160.1|GH17	1.18e-54	122	374	154	407
BCS13276.1|GH17	1.54e-54	51	373	43	360
BCS01560.1|GH17	1.54e-54	51	373	43	360
QSS63389.1|GH17	2.06e-54	122	373	135	387
AQA29345.1|GH17	6.65e-53	1	373	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.95e-11	123	377	38	285	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.07e-10	123	377	38	285	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	5.91e-42	116	374	119	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	4.15e-38	120	377	134	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	7.58e-38	112	373	123	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	1.48e-29	125	373	284	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	3.17e-29	120	372	306	559	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999778	CS pos: 19-20. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_07461-t46_1-p1.