CAZyme Information: HMPREF1541_07348-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07348-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		76855.23	5.1244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822723:694450-696754(+)

Full Sequence      

MVDIHLLPDVVHGGVDLTNSWFCFLVEYLDTVIAHYTLLNHANYAFSMQVISYWAVAALG
VLQVHAQDIQSGLGKYFVKKPPLDTPWTSEVGTRPWPEYPRPQLRRHEWKNLNGIWRYMD
ARGNDAFTGMVPTWENLDQEVLVPSCLESGLSGIQAKDARYSWYSLKFQMPGHWSDRVLL
NFGAVDYEATIYIDSAMVGVHRGGYTSFTLDITNFVEAGNDHELAVYVHDPTDAEGYNVP
IGKQTRNPSHIFYTPCSGIWQSVWLESVPQSYITRLDVYGAMDGKVTVKVSTNDNSSSPY
LLTIYKDGPKQIARTGIPNTEHTLYLPNPRLWSPDSPELYDITIKYGDDFVTSYMGFRTI
EVGKVNGVQRPLLNGKFVFQMGTLDQGYWPDGIYTPPTREAMLYDLELLKEYGFNMVRKH
MKVENALYYQACDVLGIMVVQDMPSMRPAHNVQPSDEDEAEFGRQLEEMVQQHLSYPSIV
TWTIYNEGWGQRDGSPEIAHTETVRRTDPTRLIDSTSGWHDHGAGDFSSNHHYPSPECGT
ANLAQGISKAYDPKRIGFQSEFGGLGTNLSIENLWNDARAIASIDETYAVYDDFRTWNEK
SHKFLRMLRDQVEKDACSGAVWTQTTDVEGEVNGLMSYDRRTVRSKMALHQWKIDIQALY
YAAGKRSDGDVGAEMAGR

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	105	554	2e-95	0.5159574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.02e-31	112	487	15	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	4.09e-31	101	511	3	443	beta-D-glucuronidase; Provisional
236548	lacZ	1.08e-14	257	511	207	483	beta-galactosidase.
236673	ebgA	3.79e-12	164	527	113	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	1.75e-09	162	269	67	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54330.1|GH2	2.68e-256	66	677	17	626
EAA64506.1|GH2	1.24e-253	57	667	7	613
QQK41266.1|GH2	6.45e-252	76	668	19	620
BCR88823.1|GH2	1.10e-251	76	666	35	634
EAL93747.2|GH2	9.55e-247	75	667	35	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	7.25e-112	83	644	12	569	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6U7J_A	1.39e-25	110	516	22	448	Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
5C70_A	1.95e-24	111	513	22	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	4.99e-24	111	513	47	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6ED1_A	4.22e-23	111	512	28	448	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	3.25e-25	96	487	40	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	2.57e-19	111	510	7	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|P05804|BGLR_ECOLI	2.99e-17	108	513	11	441	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|A1SWB8|BGAL_PSYIN	4.85e-17	164	526	122	496	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
sp|O52847|BGAL_PRIM3	6.39e-17	109	529	58	522	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000007

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_07348-t46_1-p1.