CAZyme Information: HMPREF1541_07192-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07192-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	KB822723|CGC13	61367.19	4.2066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822723:278905-280587(+)

Full Sequence      

MASLFVAGLSLFALTSRVVSLDSEIVFNGTCPDYVVYAGEHHGPYSEGAYNLSFQRPPLP
CRTWNSTEVEDTVERMRDIITDPDLYRVFQNSFPNTLDTAIRWHGVASNNSEEELTFIIT
GDINAMWLRDSANQLQSYLPLLTANSSIDSLASLFRGCINLQSRYINTSPHCNAFQPPEE
AGLGVSENPYSQTDEVTPPYSNQSVFECKYELDSISAFLQISHQYYITTSDLKFFDSFQW
VDTVRTILNTAYDLMNGTYAPDGQVLEQPYTFERETTSGTETLPNEGRGNPVRGGTGLIR
SAFRPSDDSSIYQLFIPANMMFSYFLSTTADIMAQLSHPDAPTLAPEMTSLAAAIRAAID
AAGLTLAPSSTSYSNLTQIYAFEVDGFGSANVMDDANIPSLLAAPFFGYDVADPRYQATR
AHVLSEVNSYFMRGPVISAVGGPHQSFGMAWPMASIVRIITAGTHPSPSTPLRPDGNGNG
NGSAAPAAAQLDAAAKAEIRQELRQLVASTDGYGLMHESVNSWNESDWTRQWFSWANGLF
GQMVLGLEGTGLLEESYQPE

Enzyme Prediction     

No EC number prediction in HMPREF1541_07192-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	82	545	2.8e-148	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	82	545	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.56e-121	61	549	2	424	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91719.1|GH125	9.18e-213	25	558	15	513
CBX94219.1|GH125	1.75e-206	31	558	65	557
AQA29358.1|GH125	2.87e-200	28	558	22	516
UJO14502.1|GH125	2.87e-200	28	558	22	516
CAE7030360.1|GH125	9.75e-198	20	558	10	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.76e-76	51	554	38	475	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.82e-73	51	554	18	455	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.43e-68	56	554	21	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	1.64e-58	69	545	12	420	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
6RQK_A	3.02e-55	65	544	4	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	8.35e-117	31	547	27	496	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999782	CS pos: 20-21. Pr: 0.9624

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_07192-t46_1-p1.