CAZyme Information: HMPREF1541_07148-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07148-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	KB822723|CGC9	79131.32	6.5933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822723:165859-168105(-)

Full Sequence      

MAYPQTLFPSVTLHPDTLLFARRKAAAQQTLHYQLSVLKSTGRYDAFKLNWHPIYSEPVP
SPGVPKHLFWDSDIGKWLEGACYILLTTPPSQRDPTILAAVDELVPMIASAQQLDGYLNI
HYSVVAPGQRFTNIRDMHELYNAGHLLEAALAHAALVHPQPSLLLQTMLRYVDLLCTLFG
PSLTQQHGYPGHPEIELALLRLHAYTREPKHLALARYFILERGNPTGCFERHFYRVEAER
RGEDPRLGLRFSGKADAWWYMQAHVPIVEQTGVEGHSVRAMYLLAAAADLCLQEGDKVAE
GKLLPAIRRLWDDMVGRKMYVTGGIGAMKQWEGFGLPYFLPQSAEEGGCYVETCAAIGVM
MLAERLLRIELDGAVGDVMELALYNAVLTGMSCDGKKFTYWNPLGSSDGALAEREEWFDC
ACCPPNVLRLLGQIGGYAYSQREAEIDVHLFISSTGTFKVGAHDVRLTQESNYPWSGDIK
FTLETTANDLVGLNIRIPGWAKDEWSISPPLPSSPTAPLLRSNYLHLPPTYLHPRPNAPS
TSTFTLTLPLHPRHLSPHPYASHPSLTLARGPIIYCVEDVDNPWVLNHTFSSGDVNPSPH
AHFRSLQIDPSFPITEALLTDAETAETYVGLTLARGGASLLDLEAVDAAFRGGRGPGVDV
SVAVGEDAQDQEGRWARGIPLKGELRFVPYYFRANRRGSRGVSRVGLRWWVR

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	16	576	3.9e-154	0.9904580152671756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	4.46e-117	69	588	63	518	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	2.27e-103	52	576	30	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW96336.1|GH127	7.15e-238	1	708	1	675
QYT01986.1|GH127	2.17e-225	1	708	1	660
UJO16417.1|GH127	3.19e-222	1	708	1	679
ATZ54433.1|GH127	1.44e-221	1	708	1	660
CCD50963.1|GH127	5.19e-220	1	705	1	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.69e-107	68	600	73	584	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.36e-102	68	600	73	584	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.94e-80	68	593	72	584	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.47e-80	68	593	72	584	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	6.66e-80	68	593	72	584	Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	1.00e-79	68	593	72	584	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000002

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_07148-t46_1-p1.