CAZyme Information: HMPREF1541_07036-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_07036-t46_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
942		102167.29	4.3505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822722:2112888-2115716(-)

Full Sequence      

MRLATYTTSPLAFLGLAAFAVAQSSTDLSWVPFDRDNFDGNVALDTNGDVQLFWRTGDTN
STFGIASRSSGYLALGFSETGAMTGADIALGYNDEDGNFIFENRHAMGFVTPQVSQDQEN
NMRLREGQQADGVTSFVFEKQNRADCLETQIDVATDAWQWFIYAFSDDNNFAIHAPGNNG
KKYVKLGTGQTVSRNEVHDVENAMNFTVVQPEVTIPTAETTYCYSLHRMPEGETSYLLGE
RPNPSSELLHHLVLYACYDPSDELLEMLDGEPNCDYEEFSNPCNGFVTEWAPGMSGRTFE
PGFGKPFGSDHYEYVMLETHYNNPEGLEGETDAAAYTFLYTEDPVETEIGTLTLGDLQVT
GWFLEPGKEIVPHSTVCTPECTDRWPSEGITAVSVFHHMHYRGVNAQVQIIRDGKEITPL
STLRHFDYGYQFSKNLDSIQLLPGDQLITTCEFDTSNDTEPVPGGLPSKHEMCFAWVDYY
PANGVLACTQREMGNSPENPINGTAAFCMESASSEADSVYDSPFLTATFENLTATGNSCP
ADNAVSGPGNQAAVLSTCPETDVCFALNVPEESASSSSGDIYFQLSAPTTYAWVALAQGT
AMNNANMFVMYSSADGQNVTLSPRTASGHVMPTYNEAADISLLEGTGISDGIMTANVRCG
NCDRWDAGTMSLSGGSSDWVYAHSQGSPINSDDTSATISQHNGQGSFQWDVSRATGGSGG
NPFTDASSTTTTGSEGQNSWQQLSTQAQMRFVQAHGALASIAFVALFPIGAILVRLTSFQ
GLLWTHAGLQVFGYTVFIAAAGLGIFIARGGAYLQEPHAIIGLLLLATLFFMPFLGLLHH
QVFKKVQKRTVWSYGHIFTGRAIVILGMINGGLGLRLASAESSHRIAYGVFAGLMGLAYI
GAIVFGEYKRSRQSSHDAAAPSSVYRESKRLNRDESGSDVSR

Enzyme Prediction     

EC	1.1.99.18:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	560	715	5.3e-23	0.8736263736263736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187688	CDH_like_cytochrome	1.15e-57	557	711	15	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
176490	Cyt_b561_FRRS1_like	3.45e-39	726	904	10	191	Eukaryotic cytochrome b(561), including the FRRS1 gene product. Cytochrome b(561), as found in eukaryotes, similar to and including the human FRRS1 gene product (ferric-chelate reductase 1), also called SDR-2 (stromal cell-derived receptor 2). This family comprises a variety of domain architectures, many of which contain dopamine beta-monooxygenase (DOMON) domains. The protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
406418	CDH-cyt	5.72e-36	559	715	16	174	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
395859	Cu2_monooxygen	8.41e-30	206	328	1	130	Copper type II ascorbate-dependent monooxygenase, N-terminal domain. The N and C-terminal domains of members of this family adopt the same PNGase F-like fold.
397669	Cu2_monoox_C	2.97e-22	350	482	4	138	Copper type II ascorbate-dependent monooxygenase, C-terminal domain. The N and C-terminal domains of members of this family adopt the same PNGase F-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7013938.1|AA8	5.06e-123	552	912	20	386
SMR42136.1|AA0	3.69e-108	551	914	20	389
SMR44317.1|AA0	3.69e-108	551	914	20	389
SMR55355.1|AA0	1.75e-102	563	922	25	377
SMR57731.1|AA0	1.75e-102	563	922	25	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZEL_A	6.48e-29	41	488	11	464	Human dopamine beta-hydroxylase [Homo sapiens],4ZEL_B Human dopamine beta-hydroxylase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08CS6|MOXD2_DANRE	1.39e-38	44	488	38	472	DBH-like monooxygenase protein 2 homolog OS=Danio rerio OX=7955 GN=moxd2 PE=2 SV=2
sp|Q6NP60|MOX12_DROME	2.35e-36	43	481	112	573	MOXD1 homolog 2 OS=Drosophila melanogaster OX=7227 GN=olf413 PE=2 SV=1
sp|Q6UVY6|MOXD1_HUMAN	3.23e-36	42	488	29	480	DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1 PE=1 SV=1
sp|Q9CXI3|MOXD1_MOUSE	1.03e-35	42	489	29	481	DBH-like monooxygenase protein 1 OS=Mus musculus OX=10090 GN=Moxd1 PE=1 SV=1
sp|Q9VUY0|MOX11_DROME	1.18e-35	15	488	18	516	MOXD1 homolog 1 OS=Drosophila melanogaster OX=7227 GN=CG5235 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999737	CS pos: 22-23. Pr: 0.9520

TMHMM  Annotations     

Start	End
757	779
791	813
817	839
852	874
884	906