CAZyme Information: HMPREF1541_06807-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_06807-t46_1-p1
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		38799.41	5.8398

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822722:1560108-1561127(-)

Full Sequence      

MVLAIPVRWTAQAITVLALLTIFFLSRHSVYDFAESRAGIESPSTSSDEKLGYVTWLGKT
GVGDDEKDVYFLATRLLVYQILHDPSTRSPRSLPIIVMTTPDVKEANKQRLQADGATVIP
IDFVTEGLDWLKPRRPTWAHIMSKLRAWQLTAYSRLLMLDGDLILRRPLDSVFDETNATI
IPTLSAPPNEIKLDENPLPAKYLFAAAPEVNGPKHHYPPTREHDDFIHAQEFNMGFALLA
PSQEMFEYYISILRIPDRFYGGKMEQSLLNYAHRPGGAMPWQDLPFTYNIRSPLEEDILG
NVASLHDKWWGKTEQYPALAGWYRAKQEEMLRFYAEREM

Enzyme Prediction     

No EC number prediction in HMPREF1541_06807-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	68	306	7.3e-24	0.8054474708171206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	3.75e-26	70	294	12	186	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	3.66e-21	66	334	79	363	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	1.78e-06	44	174	16	134	galactinol synthase
133064	GT8_GNT1	5.63e-06	76	173	17	112	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR42298.1|GT8	1.21e-68	24	322	40	339
SMY19627.1|GT8	1.21e-68	24	322	40	339
SMR44472.1|GT8	1.21e-68	24	322	40	339
SMQ45949.1|GT8	1.21e-68	24	322	40	339
QRD03274.1|GT8	1.31e-63	49	334	131	418

PDB Hits     

HMPREF1541_06807-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43062|YGT9_SCHPO	3.84e-24	49	325	70	363	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q09680|YA0C_SCHPO	6.29e-23	49	334	64	366	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43061|MU136_SCHPO	4.66e-20	50	328	56	358	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q947G8|GOLS1_SOLLC	3.37e-09	35	290	4	223	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|O22893|GOLS1_ARATH	1.25e-07	34	306	11	265	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999938	0.000092

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_06807-t46_1-p1.