CAZyme Information: HMPREF1541_06598-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_06598-t46_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		32029.30	3.9613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822722:1012752-1013792(+)

Full Sequence      

MKTTGVLATLAAPALAAYKGFNYGALDLSGATRNQASFETEFNVAKNLAGTNGAFTSARL
YTSLQGTSTAPIEAIAAAVNTETSLLLGIWISGNPNVDNEVNAIKAAIDAHGSAFTDLVA
GISVGNEDVYRITDLGIASNAGPGVTPQGVADYVNQVRSGLAGTALEGKPIGHVDTYNTF
SNSSGWMAPVIEAVDFIGMNGFPYFEDTKPNGIENGNATFWGDYDAVVGQAGDKEIWVTE
TGWPSSGPQSGAATPSVANAETYFGEVYCSLVARGINVWWYTLEDSTADASVPSFGVAEG
GSPKYDLSC

Enzyme Prediction     

No EC number prediction in HMPREF1541_06598-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	51	309	3.1e-18	0.9228295819935691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.25e-30	19	297	46	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.02e-08	18	309	22	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP82907.1|GH17	1.07e-97	7	309	9	309
QQK48355.1|GH17	2.21e-96	1	309	1	309
QIX00265.1|GH17	1.28e-94	1	309	1	309
CCT64267.1|GH17	8.75e-92	10	309	12	311
CEI68891.1|GH17	9.87e-92	7	309	10	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.24e-23	18	297	37	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	2.42e-89	7	309	10	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|A2QH21|EGLC_ASPNC	9.38e-85	16	309	18	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q4WG16|EGLC_ASPFU	1.27e-84	7	309	9	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.42e-84	7	309	9	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	1.44e-84	16	309	18	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.053943	0.946026	CS pos: 16-17. Pr: 0.9133

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_06598-t46_1-p1.