CAZyme Information: HMPREF1541_06415-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_06415-t46_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		50617.27	4.0472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822722:552974-554430(-)

Full Sequence      

MLATFALSAALLQLALAQGPSSCGPAPSGNIRPSIASGYHYQVVATGLSRPRGLHFDNDG
HLLVVESRAGRVVAFSLDEDESGCITASSPKPVTDDSDLNHGIEISPDGNTLYASSSNDA
YAWDYDSSDQSVSNQRTIVTNMEGSDHVTRTLLLSRVTPDWLVISFGSKGNLDFEAADIE
SGSATVKAFNLANRSGVYDYPTEGTLLGWGLRNEVGLVEHPSSGGIWGIENSADQLERYG
VDVHENNPGEELNFLGYLNGTDTPEQGSNFGYPWCYSAWSVDELPEHQSLEVGTQFAIDV
TSDLNGENRTDEYCANQTRSRLVFEDHMAPLDIKFNDSGRNAWVTFHGSWNSPDPVGYKL
SLVEFSEDGEPVDEATSRTAATDIFANEDVSRCAADCFRPVAMAIDQQGRIFMSSDSTGE
IYMIARDEGASSTGASPTSSSTSTSSDNAAPYLTYYTMAPYLAPALAMLV

Enzyme Prediction     

No EC number prediction in HMPREF1541_06415-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	27	424	8.9e-154	0.9850374064837906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	5.49e-22	42	429	60	399	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
271333	NHL_like_5	1.52e-04	47	119	193	263	Uncharacterized NHL-repeat domain in bacterial proteins. The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.
380207	ScyE_fam	0.001	42	70	1	29	ScyD/ScyE family protein. This family includes ScyE, a protein involved in scytomenin biosynthesis and export, and its paralog ScyD. Some members of the family contain a C-terminal PEP-CTERM domain that predictions anchoring to the outer membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74351.1|AA12	3.70e-137	15	439	17	439
CBX92733.1|AA12	3.56e-128	33	431	45	441
SMQ46525.1|AA12	9.75e-128	31	435	35	435
SMR45046.1|AA12	9.75e-128	31	435	35	435
SMR42876.1|AA12	9.75e-128	31	435	35	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	2.12e-112	33	424	11	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	2.19e-112	33	424	12	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	2.27e-112	33	424	13	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	1.21e-71	22	426	4	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

HMPREF1541_06415-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999775	CS pos: 17-18. Pr: 0.9795

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_06415-t46_1-p1.