CAZyme Information: HMPREF1541_06256-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_06256-t46_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	KB822722|CGC17	46121.19	9.4805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822722:138386-139633(-)

Full Sequence      

MMSFFASPALIFGLAFLLRAVLLIYGIYQDSTSAIKYTDIDYFVFTDAAAYVSRGSSPYL
RSTYRYTPLLSWILLPTAQGGLLFHSGKALFALSDLLAGWILMRLLVKQGHARSTALKYA
SVWLLNPMVANISTRGSSEGLLCALVLSLLYAYTAWSPTISGALLGLAVHFKIYPFIYAP
AFLLALRLPPLPQEATMPQIFNHIVSTQRTNFTLAALGTFTALNLLMFQLYGPDFLQHTF
LYHITRLDHRHNFSPYNTLLYLSSSSSSAFAIESLAFLPQLLLSCVFLPLALATRNLAGC
LLAQTLAFVTFNKVCTSQYFLWYLVFLPLYLPNSRFFLRRPKVGFAALSAWVLGQALWLQ
QGYELEFLGRSTFVPGLWVASLLFFAVNCWVLGLVVQDIVGQQGGHAEGGGKKVE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	132	394	1.2e-91	0.9885496183206107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	6.72e-79	15	397	15	416	GPI mannosyltransferase
252941	Mannosyl_trans	4.09e-71	132	393	1	256	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	0.001	47	252	39	250	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05340.1|GT50	8.24e-159	3	399	10	419
BCS16894.1|GT50	8.24e-159	3	399	10	419
UDD65877.1|GT50	1.02e-157	1	399	1	410
BAE66105.1|GT50	2.41e-157	1	399	26	435
QRD92382.1|GT50	1.67e-156	1	399	1	410

PDB Hits     

HMPREF1541_06256-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	1.81e-158	1	399	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	2.24e-154	1	401	1	423	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	6.20e-151	11	398	13	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	3.85e-147	1	401	1	430	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	3.54e-143	3	398	21	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000015

TMHMM  Annotations     

Start	End
5	27
140	157
167	189
210	232
270	292
305	327
374	396