CAZyme Information: HMPREF1541_05896-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_05896-t46_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36270.13	4.1962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822721:1624709-1625698(+)

Full Sequence      

MPRPRHSSPNPHLSLQPISLLALALTSPASAQQQNDTSSSGPGTKRGLSWIGTSHSDDDN
LLFTSSASPLTWYKTWSSWPIRSARRLEFVPMIHSLENIEQDLSNIRGGNAKYVLTFNEP
DGNTDSGGTSIDAEGAAEAWAEIAKLREDGHMISLPATTGSGPGFEWLEEFNESCWQRYE
ETGCEFDFVAAHWYGAFEGLAAWLGRLHEAWPDQKIWVTEMALPQPADEEEVLGMMNQSL
RWMDETGWVERYAWFGAFRDDEANSWTGDVVSLLDDDGGLTELGSVYMGGEAEGFPVGKS
EQGVAAGLKVQWSLVAASLSVAMAGWFWR

Enzyme Prediction     

No EC number prediction in HMPREF1541_05896-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	65	287	4.9e-53	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.22e-50	49	287	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT61160.1|GH128	1.18e-80	44	317	33	322
QRC92154.1|GH128	1.21e-80	44	317	33	323
QKD48718.1|GH128	3.48e-80	44	324	23	302
CAE7030955.1|GH128	3.65e-80	44	324	33	331
CCT72013.1|GH128	4.91e-78	44	300	23	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB7_A	2.72e-22	45	293	31	287	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UAX_A	4.44e-16	43	288	93	343	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAV_A	5.78e-14	45	288	5	254	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]
6UAW_A	7.58e-14	45	288	27	276	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]

Swiss-Prot Hits     

HMPREF1541_05896-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001286	0.998683	CS pos: 31-32. Pr: 0.9605

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_05896-t46_1-p1.