CAZyme Information: HMPREF1541_05864-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_05864-t46_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		53547.12	4.5875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822721:1543369-1544900(+)

Full Sequence      

MVVFMTLPLLTSTLLSSIVSAQVDNNLRDCLIEAANGDKGRVAWHSKFAFDILDVHRYNL
RYDTNPAAVTYPESAEEVGAIVKCAAAAKVPVQARSGGHSFGNYGIGGDDGAVVVDTKHL
NRLDYLDSDQTAHIGPGNGLKDVNDFLLEHGRFASHGDAPQVGVGGHYTIGGLGRVSRQF
GAACDNIIDAEVVLADGSIIKASKDENEDMFFAIRGAGASFGIVTDFHIKTHPAPSSAIA
YTYNLTLGSASLQADAFKGWQKLISDPDLPLKISTQFIAFPGFSVITGFFYGTEKEFSAI
NLESALPGLDSNAISIEVVDAAVAVAHDASELGLKLFGDLPAHFYSKSLSFNTSTLMSDT
AIDNMFKYLSDLDLSTLAVPYFVIFDLEAGAINDVPADSAAYAFRDSLYFLQSYAVDLLG
LFPDQATKFLDGLNEVVLEHDPNVFGSYPGYVDPYLKGARQWYWRGNYERLQEIKAERDP
NEVFKNPQSVQPKK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	57	490	4.9e-76	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	9.47e-35	61	487	27	452	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	6.60e-34	66	203	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
178402	PLN02805	1.75e-14	66	245	134	318	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	2.99e-11	61	235	60	242	cytokinin dehydrogenase
369658	BBE	1.87e-10	447	490	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7010772.1|AA7	9.78e-141	20	493	5	478
QGA17347.1|AA7	4.65e-135	27	490	9	471
UJO23499.1|AA7	3.13e-131	15	492	12	485
CCA70426.1|AA7	2.37e-130	6	492	33	517
AHG26149.1|AA7	5.86e-127	27	492	6	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	2.26e-63	54	492	49	494	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3HSU_A	2.20e-58	53	492	30	478	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	8.33e-58	53	492	30	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3RJ8_A	8.95e-56	54	494	25	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6Y0R_AAA	1.40e-51	58	493	53	491	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	2.53e-92	30	492	10	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	1.16e-62	54	492	49	494	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	2.82e-57	15	492	13	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	7.35e-55	54	494	47	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	7.22e-51	58	493	53	491	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999718	CS pos: 21-22. Pr: 0.9542

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_05864-t46_1-p1.