CAZyme Information: HMPREF1541_05225-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_05225-t46_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		40769.38	6.5055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822720:2576512-2577645(-)

Full Sequence      

MPLSPIARKGVLAAVVIIALYFFLVPSSVTTNPISTNAGAQPAPPAQPTRAYPPPSTKQQ
SIQEVATKPLRERLHYHFPYDIESKFPAYIWQTWKTAPGSGDFADRLRPFEASWTEKHPG
FVHEVITDDASIHLINYLYASVPEVTEAYEAMPLPVIKADFFRYLILLARGGIYSDIDTR
VLKPATDWLPSDFDKSTVGLVVGIEADPDREDWAKWYARRIQFCQWTIQSKPGHPVLVDI
VATITEKTLKMKAGRSFLTGQALQKSIMDYTGPGIWTDTIFKYLNNEDYFDFSQRTTNVS
YSEFFNLKEQKRIGDVIVLPITSFSPGVNQMGAGDTDNPLAYVKHEFDGSWKPEEERKKH
G

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	112	191	1.7e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.28e-45	46	352	47	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.99e-20	113	192	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11100.1|GT32	1.64e-149	49	357	45	356
QVM11372.1|GT32	1.02e-146	58	352	56	353
QKX63547.1|GT32	3.48e-145	59	357	66	362
CBV36935.1|GT32	5.13e-145	58	352	60	354
ABA38731.1|GT32	1.11e-144	58	349	27	321

PDB Hits     

HMPREF1541_05225-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.34e-96	58	352	73	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.99e-80	76	352	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.45e-75	59	352	99	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	9.17e-74	70	357	80	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.210258	0.789736	CS pos: 31-32. Pr: 0.7415

TMHMM  Annotations     

Start	End
12	34