CAZyme Information: HMPREF1541_04953-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_04953-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807		87917.88	4.3646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822720:1907652-1910075(-)

Full Sequence      

MGRQRHLLSSLLLAASSTFAQLIDYVDPFIGTEGTVPGTGYNGGNTFPGAALPFGMVKLG
PDLTSANTSINANAGYLPDGNITAFSLTHVSGTGGGPVYGVVSQMPLLSLDSVNALDNLT
YAQPRSGHDQASVGYYRSTFENGLEIELTATSHVGFMQYSFPHGGERHVLVDVSHYLPLP
GGYNQAQAYSNGEIQVSPDGLQYTGSGTYRGGFSHIPNYSVFFCGRFSSPASTSQIFTGP
YTDYFYPSDLDAQPSFLSNASYARGGPPYYNFGQRVGSLFTFPVNTSTLQSKVGISFISS
ANACAYIDAEVPHWSFNSTLTAAQSTWESTLSTISITDTTNTTRLSMFYTALYHAHLMPT
DRTGENANWETTEPSYDDFYTLWDTFRCLNSLWTLLTPARSIDMIRSLIDIWRHEQYMPD
GRSGNANGQVQGGSNSDNVLTDAFVKGLGQDGSINWTDGFAAMRTNAERTPWNNFDTGDP
TGSTLEGRSALPDWLQYGFLTPDYDRSVSRTIEYASNDFALAQVARSIAPEEYDKYLNRS
AGWQHIWDANLTSFNHSGFVAPKWANGTRDPVYDPAVCAGGCENGGYTYEALGWEYTWTV
PHDMATLIAWSGGEEETEARLDTMFTPGLKGSGVGEGENNGVGDTLFNPGNEPSFATPFL
YNYLPRRQWKSVMRSRQIVNQYYSDGPSGLPGNSDAGALDAWLIWQMLGLYPVAAQPVYL
ILAPMFSDYSMRVGLDGQVLNVTAQGLSDDSFYVQSLTVNGQAWNQSWLGHDDLKHGGSL
EFVLGSEPAPWDTGDAPPSPGHVVLDL

Enzyme Prediction     

No EC number prediction in HMPREF1541_04953-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	275	788	1.1e-152	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400362	Glyco_hydro_92	0.0	302	786	1	465	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
226067	COG3537	2.34e-139	22	799	38	757	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
273488	aman2_put	3.14e-76	22	788	34	748	alpha-1,2-mannosidase, putative. The identification of members of this family as putative alpha-1,2-mannosidases is based on an unpublished characterization of the aman2 gene in Bacillus sp. M-90 by Maruyama,Y., Nakajima,M. and Nakajima,T. (Genbank accession BAA76709, pid g4587313). Most members of this family appear to have signal sequences. Members from the dental pathogen Porphyromonas gingivalis have been described as immunoreactive with periodontitis patient serum. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
411518	lectin_1	3.11e-68	24	799	9	698	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
407572	Glyco_hydro_92N	8.51e-61	25	296	1	231	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB83869.1|GH92	0.0	25	805	41	865
UQC91576.1|GH92	0.0	13	801	15	802
CBX98616.1|GH92	0.0	9	805	13	801
CEI67665.1|GH92	8.33e-314	25	801	29	794
UKZ57057.1|GH92	1.46e-293	25	802	28	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F8Z_A	2.18e-81	21	791	6	717	Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6F91_A	4.47e-61	21	788	6	726	Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_E Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_F Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_G Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_H Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F92_A Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
2WVY_A	2.73e-60	16	788	1	720	Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_B Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_C Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_A Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_B Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_C Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
2XSG_A	2.09e-43	16	797	6	764	Structure of the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans],2XSG_B Structure of the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans]
4AQ0_A	2.31e-43	16	797	22	780	Structure of the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans],4AQ0_B Structure of the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATR3|A7629_ARTBC	3.07e-102	22	801	30	759	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1
sp|O86365|Y584_MYCTU	2.03e-55	23	801	42	769	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000521	0.999461	CS pos: 20-21. Pr: 0.9731

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_04953-t46_1-p1.