CAZyme Information: HMPREF1541_04676-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_04676-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	KB822720|CGC8	90316.79	6.0486

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822720:1182445-1184859(+)

Full Sequence      

MEERSWRCSTKGLLLLCTLIFPFVNCGHADEQVPLGGAAENDTLLWGPYRPNLYFGVRPR
QPNSLLAGLMWANADSFEAVTQGLRHTCEQGEDMHGYGWDEYDARAGGRQTIHDKGNKID
LTIDFVKSPGPGGGSWAARVKGQPMKGAPHDITTTMFFHVGLEGLGQLGFGEETNQKGDV
VLEGKSDKLGDFSIGVTQPKKNKFPKKTHASWDLRPLDQTLITSLHVPPEHLWAARNIIM
ADIKPTIDRYGKEFGQENIPPAYAAFTISNEPKTASNFHIVQKILVGAFDFDIIYNSGAG
PRLSSADLDKQIAANSKSFKAKFDQILKPLAPFTKAEFTTFSQSLFSNLLGGVGYFYGDS
LVDRSYAAEYDEENEGFWEETAEARARAQVMFDENKELFTAVPSRPFFPRGFLWDEGFHL
VPIAEWDLDMTMSILSSWFNLMDNDGWIAREQILGPEARSKVPQEFQVQYPHYANPPTLF
MIIETLVAKLESKSLPADQVQKVQAHLSSIYPLLKRQYLWFRRTQSGDIKSYDREAPSTK
EAYRWRGRSVQHILTSGLDDYPRPQPPHPGELHVDLFSWVGMMQRALIAVSTYLSETDDA
ATFTAHHTALLKNLDALHWNDHHKAYCDASIDDYEESYHVCHKGYISLFPFMTGLLPATH
PHLPHVLALIGDPEELWSPYGVRSLSQKDDHYGTDENYWRSPIWVPMNYLIVKQLHAVAT
SPDAPKAVKTTATGLYDELRENLVSNVYRQWKDTGFAWEQYNPETGKGQRTQHFTGWTSL
VVSIMAMEPLGGGSGKGGGSHGEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	572	785	1.9e-30	0.4298245614035088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	303	787	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	6.38e-103	44	261	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	8.92e-07	290	716	159	549	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	0.001	658	779	667	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02288.1|GH63	0.0	39	804	39	822
BCS13967.1|GH63	0.0	39	804	39	822
QVM12625.1|GH63	0.0	39	794	43	810
CAL00956.1|GH63	0.0	39	804	39	822
BAK64066.1|GH63|3.2.1.106	0.0	39	804	39	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.04e-164	41	785	12	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	9.09e-125	44	788	37	778	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.86e-232	12	786	19	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.98e-163	41	785	42	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.32e-124	44	788	92	833	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.01e-121	44	788	92	833	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|F4HTM3|GCS1_ARATH	1.65e-120	40	786	105	846	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006642	0.993327	CS pos: 26-27. Pr: 0.9726

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_04676-t46_1-p1.