CAZyme Information: HMPREF1541_04559-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_04559-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	KB822720|CGC11	45514.24	4.6715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822720:869502-870767(-)

Full Sequence      

MRRPLRATALFLCYLGLGLAADQGQEKQPFSQRMLASIIGRQQGVVSSGETTSTLESGFL
ALTLLSTADRYAEQASTYTGYLNRILDIASAELDNATADALLPLDRLSVGVALSDAAKPL
GGLSKNQTAAATALAASLRAQARNYLGGYLYYAGAYPTLSYLDGLFSLLPYTVAQPSPNY
TDISLQLSLLVSRCHQESSGLVTHGYDANFTYPWAERPTGKSPYVWGRSLGWFMSGLVQA
YGELCCASASRAAREELGPAETQLCDQLKTTFQDTARNLIPYADQSTGAWYQLTALPGET
GNFLESSSTLLFTWSLLKAIRLQILADMDFESTVHEASMKAYRYAAENFLVYYNMDGSFA
ESGGGNGTVGINQTVAVCSLNSTATYEYYTGRPILLNSLLGESAFVMASLEVERLGERWG
G

Enzyme Prediction     

No EC number prediction in HMPREF1541_04559-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	414	2.6e-38	0.9337349397590361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	3.82e-20	156	415	122	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	4.46e-20	156	415	128	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC88631.1|GH105	2.18e-109	34	414	1	359
QUC20491.1|GH105	1.09e-105	20	416	21	396
QLI72757.1|GH105	1.05e-103	28	415	9	377
QPG98202.1|GH105	3.71e-102	27	414	24	391
QLI74420.1|GH105	4.07e-101	19	415	9	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	6.25e-24	147	415	128	367	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.59e-23	147	415	118	357	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.36e-19	156	415	123	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	3.21e-23	147	415	128	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.69e-11	197	325	35	147	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.69e-11	197	325	35	147	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999725	CS pos: 20-21. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_04559-t46_1-p1.