CAZyme Information: HMPREF1541_04084-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_04084-t46_1-p1
• CAZy Family: GH135
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	KB822719|CGC18	75081.58	5.2941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:3079094-3081209(-)

Full Sequence      

MACLRLLMGFLTYGLMISYLSGVFAKVFVLDGIDNSLDNTTFDYVVVGCGIAGLVVSNRL
SEDSNTTVLCLDAGSLDNFEPLIQWPVFIGHQPPLFYEWGMATVPQIQLDGNSRPVPCGK
GVGGGSLINGMLWNRGSQADFDSWEELGNPGWGWSDLLPYFRKSETFTPQAYAGQDLSDA
DQIDSWNPKVHGFRGPVQVSYPEHLWPQSWAWFEALEELGIPKAEDPNDGSNGGGYFIPL
NIHPTNQTRSDARRAYWDPVSNRTNFNLGINAQVTQVLFEPVGPAYAFRHATSNRAEFGS
FRRQHPEGRSRRAFAVRFAFNSTSPHQIVSARREIILAAGGLHTPHLLELSGVGDNLLLS
SLGIQTIVDLPGVGNNLQDHALVHLNYAYQNASIASPATLFTNATYYAEAQSEYIASKTG
PFTAKPSTAIGFPSLSQITNATYSANANALASLDNASSYLLPGIGDPVKAGVAAQLPFLL
RALNKSSVPSHEILNDNSGGLDLSLMRPLSRGTVHVSSPDPWSHPTINPNWLAHPLDFAI
MREAMVFNHRLLQTPQLAVLQPSFAQVPVNASYSLLEAILRAGVGTEYHYSSTAAMLPRE
LGGVVDPNLTVYGTENLRVVDSSVFPIIPGAHLQAVVYGVAEKAADVIRGNWQERVGRLE
QALDWQVPTGEFWLWLGEELGWPVNVGGK

Enzyme Prediction     

No EC number prediction in HMPREF1541_04084-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	649	5.4e-171	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.18e-101	41	651	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.56e-100	39	651	3	534	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.32e-38	508	644	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.20e-33	110	380	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.58e-12	290	637	240	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA13089.1|AA3_2	1.24e-166	42	649	37	624
ATZ55747.1|AA3_2	1.33e-164	42	649	37	624
QIW99172.1|AA3	1.15e-161	41	643	14	644
QSZ30071.1|AA3_2	1.67e-161	42	649	37	624
UPK94759.1|AA3_2	2.33e-131	28	649	24	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	2.52e-106	39	649	3	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	2.48e-80	42	655	36	645	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	6.44e-78	37	649	1	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	5.81e-73	37	649	12	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	4.64e-68	42	651	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	4.48e-96	37	651	42	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.48e-96	37	651	42	618	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5AUN2|XPTC_EMENI	1.54e-93	34	650	30	615	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.51e-74	35	649	33	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	9.61e-72	35	651	27	598	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000006

TMHMM  Annotations     

Start	End
7	29