CAZyme Information: HMPREF1541_03621-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_03621-t46_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	KB822719|CGC21	99699.95	4.4799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:1909198-1911975(+)

Full Sequence      

MLRQVTHLSLFFSFVLPSLSEDLPQDARFSAFQSASEEANATVDAVLALAVPEGYVAAPW
YPTPHGGWTPDWAESYAKAADLVANMTLAEKTNITTGTGYFMDRCTGNTGSAHRVGFPQL
CLQDGPLGVRNTENNTAFPAGITIGATWNKELMYQRGAAIGQEFRGKGANIHLGPSVGAL
GRKPRGGRNWEGFGSDPVLQGIAARESVRGIQDQGVIATIKHWLVNEQEMFRMYNPFQPG
YSSNVDDRTLHELYMWPFAEAIRAGVGAVMSAYNAVNGSASTQNSYLINNLLKDELGFQG
FMMSDWFAQNSGVATALSGLDMSMPGDPTVPLFGDAWWAFHLTEAVLNGSVPVDRINDMA
TRIVAAWYQMGQDQDYPEPNFSSWTDDAVGLLHPGALISPQGVVNEFVDVQGDHAAIARA
VATEAITLLKNDNQTLPLSSSATLAVFGSAAAQNPDGPNSCADKGCNKGTLGMGWGSGSA
DYPYLDDPISALRRRTSNLTEYLTDTFPSTIDAGEDYALVFITADSGENYITVDGNPGDR
TVAGLYAWHNGDELVEKAAEQYDTVIVIVQTVGPILMDWSDLPSVKAILFQHLPGQEAGE
SLTSILYGEESPSGHLPYSITHQESDLPESVDLVYFELGQPQDTYAERHYIDYRYLNAHN
ITPHYPFGHGLSYANFSLSTATLTSLSPLTSLPPPPSPKLPTPTYPTTIPNPSTSPTEAI
YPPNFSRIWRYIYSYLSESDALRAYDIGQSPTTTPYPYPAGYSATQRNHSVPAGGGPGGN
PALFEPIFAVNVTVTNTGAAASTNNSTSNSTSTYTGHAKAVLQAYIQFPASTQSSFDTPP
VQLRGFAKTRALAPGESQEVELTLTRKDVSVWDVARQNWVVPDPAGEYLVWLGWSSGQLG
VACSSVTGVCAERERGPVGLGLSLR

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	325	1.9e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	9.96e-56	114	465	57	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.48e-50	136	896	118	754	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	4.16e-42	426	653	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.23e-38	136	363	86	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	1.14e-24	821	896	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7207232.1|GH3	0.0	50	912	23	864
CBX94846.1|GH3	0.0	51	918	24	869
AAB82946.1|GH3	0.0	51	918	24	870
QRC90746.1|GH3	0.0	51	918	24	869
AAB84005.1|GH3	0.0	51	918	24	870

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	1.41e-217	59	899	8	831	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	1.90e-216	59	899	6	829	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	5.16e-215	59	904	9	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	3.31e-214	59	881	27	829	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJI_A	2.45e-210	59	881	8	818	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NP65|BGLF_ASPFN	0.0	59	903	39	857	Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglF PE=3 SV=1
sp|Q4WMU3|BGLF_ASPFU	0.0	53	910	37	866	Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglF PE=3 SV=2
sp|B0Y7Q8|BGLF_ASPFC	0.0	53	910	37	866	Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglF PE=3 SV=2
sp|Q5B6C6|BGLF_EMENI	0.0	59	879	39	835	Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglF PE=3 SV=2
sp|Q0CI67|BGLF_ASPTN	0.0	59	904	40	859	Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001387	0.998587	CS pos: 20-21. Pr: 0.9667

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_03621-t46_1-p1.