CAZyme Information: HMPREF1541_03524-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_03524-t46_1-p1
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1196		126870.64	4.4068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:1648811-1652547(-)

Full Sequence      

MATFTRFISLVLLLQIGLSQAGHVGHGHLHEKREIHKRAASVNYALPGNWTYVSCTVDNV
GSRTLPSKTTASDDMSELKCIQYCDSFGYAYAGVEYGAECYCANTLRTSGVPAPEADCNM
QCAGNEYELCGGPNRLNVFHNAAAVVSAAGPATNAGPQGWGFQGCYTDSVAGRTLGVGME
TAGGPQKLTVALCTQACGAAGYNISGVEYSGECFCGNQYSNGGSPAPDGLDGCNMLCNGN
ITEYCGGPNRLNVYAKGVRSAIAPDWSSQGCYVDNVNQRTLSVGIATLGGAANMTVENCQ
NACYKAGYPIAGLEYAGECYCDTAYRNGGGPAPDGDAQCFMSCNGNSKEICGGPDRLNVY
QYVGSTPPVAPSPDNPPDPPANPDPDPTEPNDPTTPPVVPAGLPPGWSYNACYVDNKNGR
ILGHQQPDSGSQTVENCISACAAAGYGIAGLEYSAQCFCDNFMINGGAKATSETQCAMPC
SGNSTEICGGPDRMSIYSNHTFQTYAPPVAQTTDLPDGFAYQGCLLDTQARVFPYQITYY
ETNLTVPLCLARCAAYGFSAAGVEYGNQCFCGDDSDRVSSGTAYAPEANCNFNCVGDPGH
NCGGAGTMNYYTAPALNNWGTAVGDAAGEYKFLLGGVVIPLITTANRNGKVMFVEKQGTG
PPNSTGAFELDLSQTDNFDQAWRTVHGIKTDVFCSAGLTLPDKKGRQINIGGWSADSLFG
VRFFTPDGSPGNAGVNDWEENVQEVALQVGRWYPTALQLVNGSILIVGGEDGSNGAAVPN
LEVLPRPPGGQLVHCDWLERTDPLNLYPFMAILPTGGILVQYYNEAIILDEQTFEITRQL
PPVPGAVNADTSGRTYPLEGSMMILPQKAPYSDPLKVILCGGSTSYGGPTLDNCASISPE
DPTAPWELERMPSKRVMPTMVALPDGTYLIMNGAQKGIAGFGLAEEPNHNAVLYNPEAPK
GSRFTRLANTTIDRMYHNEVTLLQDGRVLVTGSDPQDYILQRFPQEYRVEIFIPPYLHAL
KEPLAINTSQPLGPNVTLSSLVNSTSLASNATSPYSNSSIAANDAACSYTQRPVYVLNSQ
GLTDPDNDVSYQHGDTISITMICGTPAKISLMGAVSTTHGNSMGQRTIFPSYTCDGNTCR
IQTPPNAHITGGPNWFMLFVLNTQNIPSFAQWVRIGGDPAGLGNWPNYDDFTLPGV

Enzyme Prediction     

No EC number prediction in HMPREF1541_03524-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	624	1193	1.5e-136	0.37861046057767367

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.96e-25	688	882	63	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
396406	WSC	5.51e-23	55	132	3	80	WSC domain. This domain may be involved in carbohydrate binding.
401164	DUF1929	3.49e-21	1094	1175	9	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
396406	WSC	3.51e-21	412	490	3	80	WSC domain. This domain may be involved in carbohydrate binding.
396406	WSC	7.73e-21	163	247	1	80	WSC domain. This domain may be involved in carbohydrate binding.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18666.1|AA5_1	0.0	47	1196	538	1706
APA11718.1|AA5_1	0.0	47	1196	33	1109
ATZ53635.1|AA5_1	0.0	41	1196	36	1118
APA12830.1|AA5_1	0.0	160	1196	38	1022
ATZ55568.1|AA5_1	0.0	160	1196	38	1022

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	8.95e-15	739	1175	245	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	4.16e-13	739	1175	234	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	4.20e-13	739	1175	239	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
5FWW_B	8.82e-06	46	139	87	178	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF1|WSCD1_ARTBC	0.0	261	1196	58	924	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	3.90e-56	622	1175	9	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q01772|GLOX_PHACH	8.44e-42	622	1017	19	446	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.45e-40	688	1031	173	517	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	3.71e-39	688	1175	144	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999732	CS pos: 21-22. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_03524-t46_1-p1.