CAZyme Information: HMPREF1541_03506-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_03506-t46_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	KB822719|CGC7	87584.38	7.1906

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:1586042-1588595(-)

Full Sequence      

MSDQIVQHDGPAILSATAEGRVGIDFDNQLVKSLLRFAKKPEDAATVAAPLPPCLEREWK
TRLNIVVQVIGSRGDVQPFVALGCELRRSGHRVRIATHAAFKAFVLESGLEFYPAGGDPQ
ELMAYMVKNPSLLPSMSAMRSGEIGKKRKIMALTLEGCWRSCISPDPDTHEPFVANAIIA
NPVSFAHVHCAQALGVPLHIMFTMPWTATKSFPHPLANIKGSEVGMGRANYWSYHFVSYL
AWQGLADVINAFREHTLGLAHIPLTEGPTMLETLQIPHTYCWSSALIPKPRDWPSYIDVT
GFIFRQPPFYQAPTELEEFLSGGSPPVYIGFGSIVVEDPQQLTSTILEAIGTTGVRAIVS
PGWSSLASVEKHTNSDVFFLTGDCPHEWLFQQVTAVVHHGGAGTTTCGLRNRKPTVVVSF
FGDQIFWGDMIFAAGAGPRPIPFETLTAETLAEGLEFCLSEKAQVAAYEIATRMCGEEGA
QAAATSFYRHLSADVMACDIVPEYPASWLYRHGSKTIKLSVQAAESLLLDGSIKAKHLDL
YSPCPLHLRHRRWDPATGVMAAMGETTTGMLNEVMGFWKRPVDLHERRLAEAVLAQQTRP
TNERESKETARNSPAHVAQMVGSSLSSAPRFMGQMLKGFVVDVPLAVTEGLRATPQLYGD
KVEHLEPVNDWKSGSVVAGKHFVASSKSAACDLWDQPEKGYAEEGMQSIGKGLVKGLVGS
LTKTGSAITGLVAYPGDGIAKSMHSLFHINIRNTIADAKRVEGRVWLHKDHKDFIAEAVV
NRFQLMQGNRDKLQVAKRRD

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	90	485	4.1e-53	0.9528795811518325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.04e-69	63	490	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.26e-41	65	484	4	391	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	5.01e-21	65	213	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92276.1|GT1	1.71e-258	10	784	62	854
QMW26390.1|GT1	2.62e-256	15	780	33	799
QMW38469.1|GT1	2.62e-256	15	780	33	799
BCR83629.1|GT1	4.55e-256	14	763	45	791
UDD59733.1|GT1	7.47e-256	14	766	54	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.51e-69	70	491	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.49e-69	70	491	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	6.82e-25	63	460	1	351	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	2.56e-24	63	448	1	361	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.32e-18	63	484	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.24e-124	62	495	155	578	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.13e-121	63	509	193	628	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	8.29e-72	35	491	1142	1609	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q4WID6|ATG26_ASPFU	1.38e-69	63	491	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|A7KAN4|ATG26_PENRW	4.32e-69	63	491	884	1301	Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999720	0.000284

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_03506-t46_1-p1.