CAZyme Information: HMPREF1541_03312-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_03312-t46_1-p1
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	KB822719|CGC25	86838.31	4.9805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:1115088-1117511(-)

Full Sequence      

MWLTIVFVVLLHGYCYSYTAPSYTNETDPYLGLSPPVYPAPQAKGSSNQHWADAYSKARQ
LLSELTFEEKVNLTGGHVGRCVGNTAAVPRLGWEPMCLSDGPSGVRDFEFASGFPAGIHL
GATFDKNLMYRYGKAVGEEYRDLGLKIALGPMGGPLGRIARGGRNWEGFSNDPYLSGAAM
GRVTKGMQETGTIAVAKHWLGNEQEERRRAELGKGEAISSNIDDRTLHELYAFAFMDALR
EGAAAVMCSYQRLNNSYACQNSKLINGVLKEELGFEGMIMSDWNAVYAGVASANAGLDLN
MPDAGWWGGNLTDAVNNGSVDAARLDDMVVRHLAAAFYVDLQAQKAGSIHRPRSQDQTPL
VAVTTEHDALIREIGAAGTVLVKNKGDFLPLKNPRFLTIYGYDAESRPNPWGNNPGIFGG
GPEENWAWNTYNGTLITGGGSGSTTPAYVISPFHAIVERMAAVQGTVRWNFISDNPGPPY
PDADACLVFINAYASEKFDRVSLTDEFSDRLINNLAANFTNVVVIVHSAGIRVVDPWIEN
PNVTAVLFAGVPGQQAGNSIADILWGDVNPSGRLPYTVAKNESDYGELLNSTVSEGPFPQ
DNFTEGLYIDYRAFDRDNIEPRFEFGFGLSYTTFEYWIQNLMSEPAWTDHREYPNASRPV
VQGGHPDLWDPVLSVRVGVGNTGTRAGYGVPQLYVSIPNAPKMQLRGFDRVGPLQPGFMR
YETFYLTRRDLSIWDVEAQSWKLQNSQDYYIAVGASSRDLHDGTVFRPSMADQVLDKKQK
SQAFVEARTGL

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	302	4.7e-59	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.05e-50	379	611	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	8.58e-50	64	431	16	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.95e-41	114	739	120	738	beta-glucosidase BglX.
178629	PLN03080	2.56e-34	56	711	51	728	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.66e-32	114	331	88	312	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS68661.1|GH3	0.0	15	760	18	759
BCR86420.1|GH3	0.0	20	759	20	759
UDD57003.1|GH3	0.0	20	765	20	761
QRD83483.1|GH3	0.0	20	765	20	761
QMW32072.1|GH3	0.0	20	765	20	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	1.14e-182	31	760	22	845	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5NBS_A	2.47e-178	21	760	7	850	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJI_A	4.14e-176	31	760	3	834	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
4IIB_A	1.06e-175	31	760	3	831	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJJ_A	3.79e-173	31	760	4	832	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5ABF5|BGLM_ASPNC	3.86e-228	10	760	10	757	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|Q2UDK7|BGLM_ASPOR	2.42e-227	10	760	10	760	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	3.43e-227	11	760	11	760	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	9.93e-225	8	760	8	774	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	8.34e-223	19	760	22	761	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999712	CS pos: 17-18. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_03312-t46_1-p1.