CAZyme Information: HMPREF1541_03223-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_03223-t46_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	KB822719|CGC31	94173.23	7.6376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:890896-893514(-)

Full Sequence      

MRSFSDKIYNSAQDAFAAAQPEFVLDEEEVPNTVSAEIDDSLPTINPVDISRPVVIGSQA
WKAVSWQPRLGDITEYSSDSDTEAGPRDPLSKEQSGEVPPPPPRPRQSSRWKEELERKRS
DSIHSLETIQQFQSRLAHTVSVGSRRSSIVGTTLWTPNAIHYRIRTRTGQGSISGASAFS
QIVEVDSTPGVNKIQVPRPFSAITTFHDQPITPLSAVHELATHDDGDRISPWRTKLHAVT
PLATSLSLGAYFAYFAYRVYATLEAQRTLHRVFPVAWLFIASEFLVSIPTCFNSAYTLIS
AGGRRRPKLRLEGNQVPCVDVFITCCNEDVDVVADTVRAACVQDYPSSRYRVIVCDDGAD
LQLRTVIEGLSLEHLNLYYHARIKIKGKPHHFKAGNLIAATEMVELLPGGAGEYIAALDA
DMIPEPDWLRCVVAHMVKDPQMGLVCPPQLFYNVPDNDPLVQSLDAFVHVMEPTKDANGV
AWCTGSGYVIRRKALEAIGGWPTGSLAEDVYTSSLLLGNGWKTAFVHEPLQFGTIPDTYT
SHLKQRTRWSLGTIQTAIKLNFCIYGDVVKNMTFLQRLSGFLFPAGELFSLFLTVVLVSI
PVVLVSGGTLVAYANYNDLRWQIRLAFIALILTRFHEFVGYLPASYRFAQRDALAHVWMT
PYHSLTVIRSVLLPSWLGIKPMAFKPTGSIKGELGERDAQNRAPLWRRCVVIIWTCECYI
HLAYVLFVLVAVALSTSRAFTSGLQDTTAKLMYLLTHAFWPPMLWIICLTAFATPLFYMV
FPPTVPDREDLLDRDPKTGVARPKPYWKKRRWGKWTFWHETQWTVCTLYSAVLFVGTFIY

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	414	597	3.6e-24	0.8883248730964467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	5.20e-99	317	557	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.02e-44	278	692	14	421	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.10e-28	321	509	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	1.57e-27	317	552	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133057	CESA_NdvC_like	1.54e-25	325	555	6	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ49458.1|GT2	1.27e-278	165	838	101	781
CCD45106.1|GT2	1.27e-278	165	838	101	781
QSZ31828.1|GT2	5.42e-276	198	838	152	795
APA12172.1|GT2	1.64e-272	158	838	98	785
QDS68780.1|GT2	6.47e-252	201	838	83	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	2.09e-29	254	674	68	486	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.59e-29	254	674	80	498	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.60e-29	254	674	81	499	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	6.04e-24	317	578	273	522	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WX75|BCSA5_KOMXY	5.80e-28	233	588	65	411	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	5.80e-28	233	588	65	411	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|P58931|BCSA_PSEFS	4.27e-27	246	555	91	389	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q8Z291|BCSA_SALTI	2.54e-24	246	578	205	522	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|P58932|BCSA_XANAC	3.39e-24	317	557	153	385	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
592	614
710	732
759	781
817	839