CAZyme Information: HMPREF1541_03217-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_03217-t46_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1350		149565.84	4.6050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:863643-867988(-)

Full Sequence      

MQSFLLKCLLPLLCLVASFHLAITHPTPQTTDLGLLQLDPDIIPGNVTHLQPRQARGLIL
RILPLGASIVRGMGSNPKNGFRKPLRDRLRWRGDQVNMIGNQNNKRDDDAGAPLMRNGQH
EGVSGDRIDQVRTRLDAVIQRKPNLVLINAGTNDATQNFEPSTARERLSGMIDKIFRESE
GAVVVLSTLLVNTISDNPRGNENVNLINNDIRAMVRQRWANGESLYLAEMNDGSFITGGD
LVDGTHPDNDGFRKMAAVFDAAIQRAYGDQKFRLPIDTGIPDFPEQDDSCAANLNANTLA
KRELTAPVRTQVGSGDHDGQYCHNSEPMGQILEQAIGGIQLDTNEVSFAQLVNQGGNPDP
SGALDDLVVYIDPEKNFGGQGKARMFVYVNDQQNFLESKEFFVNEPGQGCRARGVRWGDV
NGDGLDDFICIGLDGKMFVSINQGGSPPQFKYVNTFFSPPMATEQRQVKLADIDGDGRLD
YCRTDFNGDITCWRNGGIGMESAEYWQDLGIVFTGKGKGNIDGTQFVDINGDHRDDWVWL
DERGASDIWTNSRGVGKGMAPHWIQARCAHGGMGEDGARDQIRFARIWAYGGYDYARVKV
EPFRLGLDPTINSRIKIEAWRNKGEGGTKLRGDGNRYCDMTGNGRDDYVWFRSTGEMTLY
ENIADPPNWGQHPVPVYSFNRDRKGLHLADWNGDGKCDVLYVDRFSGAVEWWENTFNSNN
GRTPTFEFRGNVQGISRLCREGWGVGLFDLGLRFADISGNGRADYLCIERNGRTTALINE
PGGLRDVGQVKFAEPSKDRANIRFADIDGDGKADYIWVDKFNGDVSVWMNGGELPENERQ
SGSKFHWDPMGKYYDGQSRGANQYYPDFTGNGFADLHYIDPVTNQAWTQFNDDCNGDGSG
QDDPDQNPDLPAYDPGDNTERGTDSPSNPNPWSPEFPDQPTWVALGDSYSAGVGAGGGYE
NPRDPNRKCLTTTNAYPFQLERSVSVLSGKLDFLSCTGDLITHINQSPSKDRTSQVEMLR
TIDSSSYDFATLSIGGNDLGFSGVVKWCILGILPRYSSRCEEKLRRAETLAGITNPGNGD
QNGLSRNLLTAYMDILDTASADFTLVVTGYAAFFSEANDRCDSTTIGILEHYNLEPEYFA
PPLTMALRQRINRGVRAFNAMIQEAVQEAQQQLDNQGVRKRIRYIDIDTLFEGHRFCEPT
EGDDIANVGGAWFFLPWGRDIQPDGTSIDPRDPANDPPADHTRRDEAFCEDPYTELECAF
AQAVEENPDAGVNGAIYPRDLMQELKDWADDKKEMLKTKFMKAFHPRTIGYAAVKDEIIS
QHAFWASESGLMGGPTLSSASFGSNSTSSS

Enzyme Prediction     

No EC number prediction in HMPREF1541_03217-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	60	263	3.2e-47	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238861	SEST_like	4.00e-34	942	1223	3	241	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
238871	XynB_like	8.90e-30	60	263	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.79e-13	122	254	40	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.91e-13	62	262	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238860	Lysophospholipase_L1_like	3.99e-12	61	186	2	106	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56943.1|CE0	1.82e-199	13	923	13	875
AEO70515.1|CE3	6.08e-154	45	886	81	884
EAA58486.1|CE0	3.27e-151	53	912	53	918
UPK91538.1|CE0	6.79e-148	60	910	63	901
CCT73237.1|CE3|GH43_30	2.95e-146	54	916	73	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HYQ_A	8.94e-10	942	1197	5	199	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]
5MAL_A	1.27e-08	942	1197	4	198	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9S2A5|LIP1_STRCO	2.88e-09	942	1200	38	234	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	9.78e-08	942	1197	38	232	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001551	0.998421	CS pos: 24-25. Pr: 0.9438

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_03217-t46_1-p1.