CAZyme Information: HMPREF1541_02939-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02939-t46_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	KB822719|CGC15	64372.44	4.3888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:83475-85408(+)

Full Sequence      

MVLANRLSQVPEFRVLVLEAGPEPTVVINYESPGGNQALGGTAIDWNFYTTPQEHLTDRV
LFYRRGKALGGSSTTNGLFYGRGSASVYDNWVKLGNPGWGWEDLYPLAIKSTHFNPPIDN
PEWDHSYTTWDPCAYGEGPLQIGYQGYVAPSCIGFIEACEVINIPIVEDLNSGNNTGVKQ
GTGNLDGNLRRSSAFDSYYQQAKDRPNLDVLHDTWVERIHFEKTDNGSSRATGVQFTDQL
TGEFHVVHAAKEVILSMGAFASPQMLMLSGIGPQAELERFNMDPVYVNENVGQNLNDHHV
FSIYAKAEEFSSSSSMYENSSTLEAAREEFYRSLSGRWTSPSGITNAFQKMTEEELRRIG
ADAIIEAGLLNQSHMEFLYENQFYPGGPTFFPDTAQVAADTGSYYWPQANESYFSLTAQT
LVALSRGNITLKSTSAYDDPNINPNYYADATDRSIAIKAFKDLRRLLAHPALSVFTIGPN
NGEVCPGHDHVPDDADDDTIFEYIKANTIPNWHASGTCQMLPEENGGVVNSRLQVYGVEA
LRVIDVSIIPVLPDVNVAGPVYMIAEKGADIIKEDWGVAGKGDD

Enzyme Prediction     

No EC number prediction in HMPREF1541_02939-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	575	5.7e-154	0.9735915492957746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.92e-83	2	575	21	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.56e-78	2	573	19	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.94e-36	425	567	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	9.00e-35	59	300	17	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.08e-25	3	579	70	584	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60141.1|AA3_2	3.11e-253	1	576	43	606
QSS67839.1|AA3_2	4.02e-240	1	577	51	611
QSS49367.1|AA3_2	1.63e-239	1	576	51	610
CEF73970.1|AA3_2	2.69e-233	1	576	47	608
QPC76270.1|AA3_2	2.69e-233	1	576	47	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.60e-71	1	575	18	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.43e-66	2	575	15	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.66e-66	2	575	16	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	6.31e-55	1	580	18	590	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	1.70e-52	1	576	53	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	2.66e-63	1	574	53	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	1.36e-62	1	567	63	619	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.89e-62	1	567	64	619	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q12062|AFLK_ASPPU	3.44e-62	1	567	87	634	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|C8VDT4|STCN_EMENI	8.03e-59	1	572	80	636	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000021

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02939-t46_1-p1.