CAZyme Information: HMPREF1541_02938-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02938-t46_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		49266.93	4.5429

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822719:79963-81315(-)

Full Sequence      

MLVSKITLLSLLASHLNAQPTNELSAAYGENIYARLWRTALTGNLKEGSVDAWPHYTQGA
YNNTSPSEVTPGVYVNTEASGWTSGFFPDALWQLHRRQKSLCHQPFEGAPSTDQWVVMAQ
AWTSPLQSNSNLTSTHDLGFLAKPFESAMQINGDNWLSVLQNMSNNLANRFEPNAGIIRS
WDCNNASSSAWCSHEDSVLVIIDNMMNLALLVRSASNYTHNQTLLDIAKSHADRTIANHV
RQDGSSYHVCDYSSTSGDVYLCRTAQGLADDSTWARGQAWGLYGFAELYSLTGQLPYLHA
SMEMADWFIEHLPADGLPFWDFDADYVPDLTPRDSSAATIAASGMLLLQEQVFASCYAGI
ARNYKVAAVNLLTASIKLALAGEITFSDMPPLGADTYLSTAASTAESEGFEAILLHGTSN
NNPKADPKLFDIGLSYGDFYLIEAANRLLE

Enzyme Prediction     

No EC number prediction in HMPREF1541_02938-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	77	377	6.8e-76	0.851063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	0.001	205	346	132	265	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO13818.1|GH88	1.37e-165	25	448	24	469
QRW09141.1|GH88	2.52e-72	56	450	43	394
QRV80342.1|GH88	2.52e-72	56	450	43	394
QRV94836.1|GH88	9.91e-72	39	450	26	394
QRV93421.1|GH88	3.63e-66	44	450	42	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.70e-46	45	450	32	390	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	5.11e-30	44	352	16	296	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	2.49e-29	44	352	16	296	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	1.09e-21	73	345	59	314	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.10e-21	73	345	60	315	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	2.38e-43	55	447	50	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	2.63e-29	44	352	16	296	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	9.03e-22	73	345	58	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	5.68e-21	73	345	60	315	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	3.50e-20	76	450	67	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999680	CS pos: 18-19. Pr: 0.9816

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02938-t46_1-p1.