CAZyme Information: HMPREF1541_02647-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02647-t46_1-p1
• CAZy Family: CE16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	KB822718|CGC2	62219.08	5.8625

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:3015753-3017501(+)

Full Sequence      

MASPSEPKYEFIVVGAGPAGCVIAWRLASSAARPKVLLIEAGGDNAGTANRVDAERWIHR
MSPGQNWGYQSIPQEHLGGTVIPLDRGKGLGGSSAINFSCWTIGPKDDHDEIAELVGDDE
WKWSNAQPRYKRIETYHAPSGLDGYLEPNLADHGHQGPLNIGFPATWERTLEPLLESGIQ
YGMKKNVDPNNGEPIGMGIVASTAYSGHRTTAADFLVGAPSNLHVLTSTQVARVIFEGQT
AVGVETLESANLFASKEVILSCGSLDTPKILMHSGIGPEDQLNKYGIQVLQHNANVGQHM
MDHHHLTLNYLRADHTTTRHTYYRSKQLQAAARAQWEKDGTGPLSEIGTGLGIAYLKLDR
MYETKEFQELDAKTQAFLKRPNVPLWELLVNGASPAHFIDPENAPAMTTMFIFVMNTQSR
GTVTLQSSRPEEPLVYDEGFFSHPYDRRLAIEMTREALKFVESPAFSKDTVGVLGPELPA
SASEEQILDAWRKGTGSTWHMSGTARMGRNAETAVVDNTFRVFGVDKLRISDMSVYPLLP
NNHTQTSAYLVGLMLGDKLVDEYHLE

Enzyme Prediction     

No EC number prediction in HMPREF1541_02647-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	559	1.7e-143	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.28e-89	2	560	1	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.22e-78	5	561	2	529	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.10e-33	418	555	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.83e-27	9	562	56	579	Protein HOTHEAD
366272	GMC_oxred_N	1.47e-25	78	278	15	204	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95388.1|AA3_2	7.13e-182	1	565	1	571
BCR99292.1|AA3_2	3.51e-173	1	563	1	563
BCS11595.1|AA3_2	3.51e-173	1	563	1	563
CAK46531.1|AA3_2	9.95e-173	1	566	1	566
UNI19531.1|AA3_2	9.57e-169	9	565	6	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.54e-52	9	563	7	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.13e-52	9	563	7	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3FIM_B	2.44e-52	9	557	3	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5ZU2_A	2.94e-52	9	563	7	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	3.32e-52	9	552	2	554	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DO29|ERIK_HERER	3.71e-58	8	557	33	593	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	3.78e-58	4	549	36	585	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q5B8A1|PKFF_EMENI	3.25e-57	9	557	41	605	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|V5NC32|PDH1_AGAXA	9.38e-55	4	564	36	600	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q3L243|PDH2_LEUMG	6.57e-54	4	564	36	600	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000006

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02647-t46_1-p1.