CAZyme Information: HMPREF1541_02589-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02589-t46_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		49599.25	6.4494

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:2845681-2847006(-)

Full Sequence      

MGSVQLKRYAIVGCGVRSSFYYSSILNDHSDVATLVGLCDTNQTRMNAANDRIVELGGSR
LPTYKESDFDKMVAEQQPDVVIVTTIDKFHHVYCIRALELGCDAITEKPLTIDEEKLQAM
IDAEKRTGKQIRVLFNYRYAPHHTKIRELIASDTIGEIATVHMDWILDCAHGSDFMRRWH
RDKANSGGIQMHKSIHHFDLVHFWMDTEPVLVYCLGDLRFYGRENAERRGVKNLGERYLN
NDEAKSDPFAINIEKNAQLKKLYLEAEHEDGYIRDRNCFADGISIEDNLSMIIKYSNRAV
MTYNTYAYAPWEGYRCVFNGSKGRIEINVVEGGYSAGGEAVTNQGLGDLEKNYIQGGVEQ
TKIVVYPLWDKPYVVDVEKGSGGHGGGDPVLLEDVLVGKKEDQFKRAAYLRAGGNAVLVG
VGANHSMKSGLPIKVQELVKW

Enzyme Prediction     

No EC number prediction in HMPREF1541_02589-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	8	171	6.3e-25	0.40852130325814534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	3.16e-40	8	223	5	213	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	6.68e-17	7	135	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	3.23e-12	147	435	1	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
182305	PRK10206	3.79e-05	67	165	54	154	putative oxidoreductase; Provisional
281446	NAD_binding_3	6.45e-05	13	133	1	115	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV32364.1|CE9	8.77e-25	8	212	396	604
UPK44969.1|GH0	2.91e-13	8	285	5	268
URQ89907.1|GH109	8.26e-10	3	392	51	425
AZZ99370.1|GH109	1.03e-09	4	158	52	206
AEG10834.1|GH109	1.03e-09	4	392	52	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3E18_A	3.08e-14	4	217	1	206	CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3MOI_A	5.04e-12	8	201	4	186	The crystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]
4HKT_A	2.09e-11	8	212	5	191	Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_B Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_C Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_D Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021]
3Q2I_A	2.43e-10	8	213	15	212	Crystal structure of the WlbA dehydrognase from Chromobactrium violaceum in complex with NADH and UDP-GlcNAcA at 1.50 A resolution [Chromobacterium violaceum]
3Q2K_A	8.25e-10	8	238	32	251	Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_B Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_C Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_D Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_E Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_F Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_G Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_H Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_I Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_J Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_K Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_L Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_M Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_N Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_O Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_P Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34371|YTET_BACSU	5.31e-73	11	438	4	422	Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) OX=224308 GN=yteT PE=2 SV=1
sp|P77503|YCJS_ECOLI	6.69e-12	8	158	11	153	D-glucoside 3-dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=ycjS PE=1 SV=1
sp|O68965|MI2D_RHIME	4.46e-11	8	212	4	190	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
sp|A6WQ58|GH109_SHEB8	1.84e-10	4	392	52	397	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS185) OX=402882 GN=Shew185_2813 PE=3 SV=1
sp|A3D6B7|GH109_SHEB5	1.84e-10	4	392	52	397	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02589-t46_1-p1.