CAZyme Information: HMPREF1541_02516-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02516-t46_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873	KB822718|CGC26	94409.22	8.2547

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:2667116-2669978(+)

Full Sequence      

MGFDGVTVSEQVRTLIEHYHVGSILLTAKNLKSAAQTTQLVLDLQQIAHDAGHPVPLLIA
IDQENGGVNSLYDEVYIRQFPSAMGMAAAGSKKLAKDVARATAQELSSCGINWILGPVLD
VLTNARNQPLGVRSIGDDPQEVSAYGVECMKGYQEAGLATCGKHFPSYGNLEFFGPPTDV
PTITDSLESLSQSALVPFRNAIASGIDSMMVGGVAMSSSGVNVMHACLSEQIVRELLRNE
MQFEGVVVSECLEMEALSRNIGISGGTVMAFQAGCDLILTCRSLSVQEEAINGLKAGLDN
GMIERFRVQESVQRVLAMKSIYTSWERAFAPLGIDNLNRLQPLHTGLSTAAYNKSITIVR
DQKRYLPLSKLLRTEEELLLITPLVKPLPASANALLHHESSELPITDPHFSWDPNASVMS
GEKVFRELGRALARQRNGKVAHTSYTANGIRPVHETLINRAGAVIVITADAGRNKYQHAF
AKHVSMLCKLSTGLNGQMKEKPCIVIAVSSPFDFAADTSIGTYVCTYDFTETALQAAVRV
IYGEIAGTGILPGSFGHKHQSKPTRQQWLVENFKEDRDAAALDNLLKEAAKDGSVAAGLL
QGSNSSTFLLRSAAVDESHFVVRNSTTKQLFGFCATYYSKAAAVGCIAAIVVDPSRRRLS
IGHSLHDRAIRALLQNKGVKKFQLGSRLPNVFLGIPKADTAEYRAARQWFAKLGWNVSLA
NTVYTLVIDNLGSWSPPDGLGKSLSSADIKYDQVSGGEYAIPVMEHLKRCARSDLLDVYN
MALENKEASSIIRAKRATDGAVMGTVLMLRADSKFASFAPGLLNNSTKGCISAPVISPAT
NDRYAMLQGLVLLGVRQLKRQGVATIVLDRVSR

Enzyme Prediction     

No EC number prediction in HMPREF1541_02516-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	55	279	5.6e-55	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.28e-67	1	370	10	352	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.05e-63	2	316	13	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.83e-37	5	318	10	305	beta-hexosaminidase; Provisional
185053	PRK15098	4.63e-10	79	250	119	287	beta-glucosidase BglX.
178629	PLN03080	1.48e-08	80	370	114	417	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	1	872	15	889
BCS21378.1|GH3	0.0	1	869	25	892
BCS15461.1|GH3	0.0	1	872	25	896
BCS03847.1|GH3	0.0	1	872	7	878
QGA17051.1|GH3	0.0	1	872	25	917

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.71e-89	2	758	20	720	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.30e-62	2	552	24	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.41e-43	8	552	73	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.19e-43	8	552	47	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.05e-42	8	552	77	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.78e-42	8	552	73	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	1.02e-32	10	370	46	400	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.42e-32	7	557	50	598	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0AF74|NAGZ_NITEC	5.00e-31	5	312	12	317	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	2.60e-29	5	294	10	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02516-t46_1-p1.