CAZyme Information: HMPREF1541_02377-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02377-t46_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	KB822718|CGC15	72064.58	9.6941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:2295780-2297767(-)

Full Sequence      

MATLLNGIAASDSSKIPNRPVNGYDIQSYAPRPPSAISKLGPLIAAIQLSSVVSYLYYLC
KASHGSKLVVPRLFFAAQVIEFFSVISDLFVSLTGQLLCKNESRPRRRLHGDNVPAVDVI
ITTCKEDTDTVMDTVRAAATLDWPANKLRVLISDDGPDPELKAQIEQLQERYPSVHYYSR
PKIPGKHHGFKAGNVNQAIRHLASEKLRQFAAQYVGILDADMIPDKMWLRALVPHMLIDP
ELAMITSPQDFYNIPLNDPLHENLILQHEAEQSLRDKMGAAWCPGSGFVFYRPAWEKIGG
FSETSMCDDVLFGWTLNGKGYRTAAISERLQSGQQPSNFVDHIKQRRRWTVGGMRNAREL
GYGTDAKLLGNSTPWQKLAAFNQLPKPFIGTIGKAFVWTVVFFSLLSGQPVVGSTSKSEL
AKILILYAVFVVASRVAEYMLALGFGIQNIRRRQIVATWQGMHLAKACIQEMMPSSVGGA
SLGFLVTGQKNATDIGLGERDPTQRPRMLERIRRLHKIEGVLNHLWFFLTMISLFSMQAI
RLYSKTTSGTLLHAMIVSGLFPGLRLENLMAFLSPIRYIMFPPTEKPRVSYLTEDPDTGF
RRPLVWERGAKFTRGMYVWEAWYLVATAWAVYAAYAVAIEADMV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	117	352	4.5e-20	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	5.38e-79	115	355	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	4.58e-35	79	459	14	386	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	2.11e-26	125	355	8	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
236918	bcsA	3.03e-26	115	377	260	507	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	2.35e-22	119	309	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY01550.1|GT2	2.60e-88	21	631	150	761
QLI64665.1|GT2	1.78e-81	100	603	240	740
XP_748682.1|GT2|2.4.1.-	4.87e-81	80	628	170	715
EAL86644.1|GT2|2.4.1.-	4.87e-81	80	628	170	715
CEI40044.1|GT2	1.67e-80	100	629	310	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.95e-20	115	352	273	500	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CW87|ACSA1_KOMXY	3.66e-23	112	421	146	440	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|P58932|BCSA_XANAC	1.14e-22	115	390	153	414	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|O82859|BCSA2_KOMSB	4.86e-22	112	414	146	435	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	1.11e-21	112	352	146	376	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P58931|BCSA_PSEFS	1.92e-21	115	390	159	420	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000026

TMHMM  Annotations     

Start	End
423	445
521	540
550	572
617	639