CAZyme Information: HMPREF1541_02164-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02164-t46_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	KB822718|CGC1	40697.57	6.5731

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:1719462-1720632(+)

Full Sequence      

MFGQEKYDWCLRSVPQAGLNGREVSQTRGKLLGGSSAIDSHSPVYPNRGMHDAWAGLVGD
QRGAWEGIEDCYKKFQHVVAEGGGSGLFKGPVKASLPLKLNRLQQAWHGTFKELNATATD
ALRGQAIGGTTTTNAIDNRPGRGERSHAGNAYLTPANEQANLTVRTVSLVEKIALRKENS
MLRAEGVYYMSAGQHCFVEATKEVILCAGVFSSPQLLELSGIGQRAILDAAGVQPVHELQ
GVGENLQDHLNYGASIEVRPEIETMDIRDYDPSAIADQQRPYHQDKTRPLAEGSAYSFAY
LPLQLLDNETDDATLRDALAAHKATHPWFEQNQYIYDSLLSPKAASATVFMTRKARYTSK
LTAADGEYTSIR

Enzyme Prediction     

No EC number prediction in HMPREF1541_02164-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	354	7.4e-75	0.6073943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.63e-43	2	250	58	300	choline dehydrogenase; Validated
225186	BetA	1.04e-39	1	254	56	308	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.22e-18	20	250	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.85e-08	115	248	197	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52868.1|AA3_2	3.94e-88	1	371	61	461
QRC94714.1|AA3_2	8.38e-71	3	356	64	427
QSZ30689.1|AA3_2	6.11e-58	1	360	65	423
CAE7193136.1|AA3_2	2.87e-55	7	357	70	412
QMW48092.1|AA3_2	3.61e-48	8	347	61	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HA6_A	3.53e-25	7	250	56	293	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	5.28e-25	7	250	72	309	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4H7U_A	3.10e-24	8	309	98	403	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.70e-23	7	346	58	407	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.71e-23	7	346	59	408	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2H3D1U1|ARMD5_ARMGA	8.74e-32	1	325	96	433	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.39e-30	6	257	104	369	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.39e-30	6	257	104	369	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	5.17e-29	1	332	64	405	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	5.17e-29	1	332	64	405	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000004

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02164-t46_1-p1.