CAZyme Information: HMPREF1541_02153-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_02153-t46_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	KB822718|CGC13	91944.17	6.1267

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:1697748-1700264(-)

Full Sequence      

MTQHPPLGHFDIEDVLTKLDTVEKISLLSGIDFWHTFPVHRLGVPSIRVSDGPNGVRGTR
FFQGVPAACLPCGTGLAATWDTDLIHRGGELQGAEAKAKGAVVILGPTTNMQRSPLGGRG
FESFSEDPVLAGEMTSATVRGIQSTGVGATAKHFVTNDQEHERMSVDSIVSERALREIYL
MPFQIAQRDAKPWCYMTAYNRLNGTHLSENPRILQQILREEWGFEGLVMSDWFGTYSAAE
SIKAGLDLEMPGPSYARGEQVSQALNCRKLLPKDLDPCVREVLRLIKRTQPLGIPEDQKE
STVDTPETAKLLRTIGSNGLVLLKNAKRVLPFSKEKTTAVIGPNATVAAFSGGGSASLLP
YYARSPLDGVQAACSKTKYALGAPGWKKLPLLEQRVKAKSGKHGLDMKVYLDPPSNHSRK
PFDELFISTSDVLLADYKNPAIPKDFLFYATIEGTLEVEETTEYEFSISVAGTGKVFVDG
KLVVDNETKQVKGDSFFGSGTREELGRMHLEKGKSYQILITFGTLPTMTLASSGATAFGA
GGFRVGCERVIDYEQERKRAVELAKEVDQVVLCMGLNKDWESEGYDRKHMDLPEGSDELI
KAVCAANPNTAVIVQSGTPVTMHRWLDGANAVVQAWYGGNETGNAIADVVFGEVNPSGKL
PLSFPVRNEDNPAFLNYRSERGRTIYGEDVYVGYRFYEQTKKEVSFAFGHGLSYTTFDIT
DLTVEDGKNEFTVAATVANTGRVDGAEVVQVYVSQNAPSINRPPKELKGFKKVHLKAGEK
ETVQLKINKKYACSFWDEDTDSWIMERDEFEVLVGNSSQSVTKAGSVNVKETAHWKGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	39	251	1.1e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.26e-80	41	824	101	760	beta-glucosidase BglX.
224389	BglX	8.57e-69	41	373	57	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.89e-55	537	694	61	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.11e-37	23	788	64	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.95e-37	41	285	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO24157.1|GH3	0.0	10	838	6	834
SMR61167.1|GH3	0.0	10	838	8	836
SMQ55981.1|GH3	0.0	10	838	8	836
SMR64317.1|GH3	0.0	10	838	8	836
SMY29662.1|GH3	0.0	10	838	8	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.44e-274	7	838	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.73e-268	10	838	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.26e-142	11	832	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.93e-129	16	829	9	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.03e-116	12	836	4	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	1.15e-307	11	838	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.15e-307	11	838	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.63e-307	11	838	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.50e-304	10	838	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.63e-304	7	838	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000003

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_02153-t46_1-p1.